SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|210547|fgenesh1_pg.scaffold_123000047 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Nemve1|210547|fgenesh1_pg.scaffold_123000047
Domain Number - Region: 13-111
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00118
Family MgtE N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|210547|fgenesh1_pg.scaffold_123000047
Sequence length 138
Sequence
MWDWVQRVIEAMMWDWVQRVIEAMMWDWVQRVIEAMMWDWVQRVIEAMIWDWVQRVIKAM
MWDWVQRVIEAMMWDWVQRVIEPMMWDWVQRVIEAMIWDWVQRVIEAMMWDWVQRVIELI
MWDWVQRVNDPMIRSVVK
Download sequence
Identical sequences A7SDE0
jgi|Nemve1|210547|fgenesh1_pg.scaffold_123000047 XP_001630357.1.94760 45351.JGI210547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]