SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|224027|fgenesh1_pg.scaffold_3753000001 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|224027|fgenesh1_pg.scaffold_3753000001
Domain Number 1 Region: 123-234
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 3.14e-33
Family KorB DNA-binding domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 41-133
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 3.92e-26
Family ParB-like nuclease domain 0.00033
Further Details:      
 
Weak hits

Sequence:  jgi|Nemve1|224027|fgenesh1_pg.scaffold_3753000001
Domain Number - Region: 319-347
Classification Level Classification E-value
Superfamily LexA/Signal peptidase 0.0022
Family Type 1 signal peptidase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|224027|fgenesh1_pg.scaffold_3753000001
Sequence length 349
Sequence
MAKAVKKQALGRGLSALLKDPTNDIKSVEDKGAEKVVGSIIELELDAIEINPFQPRSNFN
EETLKELATSIKELGVIQPITVRKLEFNKFQLISGERRLRASKLAGLETIPAYIRIANDN
ESLVMALVENIQRHDLDPIEVAMSYQRLIDEINLTQEELSDRVGKKRSTITNYLRLLKLD
PIIQTGMRDGFISMGHGRALISIEDQDVQSDIYHKVVTLSLSVRETEALVKKYQDSLKPS
TVKXKDSSFDIDEIEKKAFTSFFGTKVDVKVATNGFYILYVNYTQEVTYFEKRDLKAPNK
AMDTVGSLAFAIVVATFVHTYFIQPYTIPTSSLEKSLLIGDFLFVIALF
Download sequence
Identical sequences A7T931
jgi|Nemve1|224027|fgenesh1_pg.scaffold_3753000001 XP_001619602.1.94760 45351.JGI224027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]