SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|224462|fgenesh1_pg.scaffold_4795000002 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|224462|fgenesh1_pg.scaffold_4795000002
Domain Number 1 Region: 86-210
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 7.46e-31
Family Helical scaffold and wing domains of SecA 0.00057
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.01e-23
Family Tandem AAA-ATPase domain 0.0000938
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|224462|fgenesh1_pg.scaffold_4795000002
Sequence length 337
Sequence
MAGRGTDIKLTPEVKDAGGLAIIGTERHDSRRVDRQLRGRAGRQGDPGSSQFYVALDDNL
MRIFGSERIAKMMDRMGLKEGEVIQHSMITKSIERAQKKVEENNFGIRKRLLEYDDIMNA
QREFVYKRRKHALDGDRLKIDIANMIYDTCQAVVNQNKPTKDFQNFEFELIRFSSMTSPF
SEEEFESMDEQALIDQLYEKIQEHYLDKIARSAVVAYPVIKDVYENEGDRYERIVVPFTD
GVKDLQVVTNLKKAYETEVTLPPIELIETGPVTSVNLKLFNEVDNSTSPSKLDKLDALEL
KYTYCLLEISFSSQPLVCHFNLIELGILIKYFSLPNH
Download sequence
Identical sequences A7TAD6
45351.JGI224462 jgi|Nemve1|224462|fgenesh1_pg.scaffold_4795000002 XP_001619137.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]