SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|225626|fgenesh1_pg.scaffold_9873000002 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|225626|fgenesh1_pg.scaffold_9873000002
Domain Number 1 Region: 23-143
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000741
Family Tetracyclin repressor-like, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|225626|fgenesh1_pg.scaffold_9873000002
Sequence length 154
Sequence
MLNQVRLPPEQLAERMRGCPEHDPLQTLRELCIEAIENLAREPQKKRIFTILLRKCEFTE
ELREAEERQEAFINLFIALCEQQFNTPSVRLRLHAGLTPRLAARTVHALLIGLFYDWSRD
PNLFDPLSDTAPMIDACFRGLIRDWPNPAVLTPG
Download sequence
Identical sequences A7TDG7
45351.JGI225626 jgi|Nemve1|225626|fgenesh1_pg.scaffold_9873000002 XP_001617975.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]