SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|225911|fgenesh1_pg.scaffold_14258000001 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Nemve1|225911|fgenesh1_pg.scaffold_14258000001
Domain Number - Region: 1-68
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0706
Family Outer membrane efflux proteins (OEP) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|225911|fgenesh1_pg.scaffold_14258000001
Sequence length 244
Sequence
MRCLFVALLTGVLLSGCASPSHDPSGTWINQAAIEAAVRNGNLREALLAYGPNLEWQLDI
QRQLASFSNGFERAEGSIERQADGALRVHFYGDFQETLSLSGDELIQAQSDTWPEQRFVR
APAAPSPLAPPGSSFEQALYSAYLGGTWLIKEGIGEGGLVLFQADGSLQGLPGAERYALC
LAGDCAAMSEEFDSLWLQLGDQGQSWLFEREGDQLRVFEALNRSQIDEMPSYYKGQQRWL
LVKH
Download sequence
Identical sequences A8DW55
45351.JGI225911 XP_001617654.1.94760 jgi|Nemve1|225911|fgenesh1_pg.scaffold_14258000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]