SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|231576|fgenesh1_pm.scaffold_5048000001 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|231576|fgenesh1_pm.scaffold_5048000001
Domain Number 1 Region: 76-299
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 7.85e-76
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00000181
Further Details:      
 
Domain Number 2 Region: 3-76,307-416
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 5.76e-42
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|231576|fgenesh1_pm.scaffold_5048000001
Sequence length 456
Sequence
MNKKVILLILDGWGITQDPKVSAIYNAKTPFINSLYDDFPHASLRTDGEHVGLPEGQMGN
SEVGHMNLGAGRIVYQNLAKINIAVRKGELAQEQTLIDAFTYAKKHNKNVHFLGLVSDGG
IHSHINHLKGLLDAAKQHQLNNVFLHAFTDGRDCDPKSGNYFINDIQDYMDNTTGTLATI
TGRYYAMDRDKRWERVKISYDALVNGIGEKSTNASKSILESYNTGVTDEFIKPIIMTDKL
GNPKATIKEDDVVIFFNFRTDRGRQLTQVLTQKDNHEYNMHKLPLHFVTLTNYDETFKNI
NVIYNNDNIENTLGEVLASAGKQQIRIAETEKYPHVTFFFSGGREKEFKGEKRLLCPSPK
IATYDLKPEMSAYEIRDAIVPELEKGEVDFVCLNFANGDMVGHTGVFEAAVKACEAKING
FILIMVTTVKAMHVCFLEVFYYKMPLVVVEVPLPNN
Download sequence
Identical sequences A7TAM1
XP_001619050.1.94760 jgi|Nemve1|231576|fgenesh1_pm.scaffold_5048000001 45351.JGI231576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]