SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|246709|estExt_fgenesh1_pg.C_2350017 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Nemve1|246709|estExt_fgenesh1_pg.C_2350017
Domain Number - Region: 173-214
Classification Level Classification E-value
Superfamily DNA primase core 0.0549
Family Primase fragment of primase-helicase protein 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|246709|estExt_fgenesh1_pg.C_2350017
Sequence length 504
Sequence
MASRAMLVCRNIFAIFLCLSGTYGISGDPHKAFIIQEAEKTESASRVFIASAPHYVSFLK
NAGEIPSHEVSSILSLALGITVPKDIQWAGLLAGDIFRRPKANILISVDGVTKGDKFELP
AKASFPVQETESAPGLSDILSTANAEGETLAARVSKMFSGKPLTLSISSSEMMAGLGSGF
GENSHTFVWRQKPEKFMLTDDDNAGIFADMQCSKAQFLAKFEKASFGQGVSFSKSAGVFT
VSLPGQEKAVFDMEKQEDFLLFAEIQMMSDALEKLKSNPKLTSDGIPDVITLTVSSLKMI
RNRYGKDSLQAKAAVQLLKSVLPKLTAGYADLYHGDALVEVLTTEWHGDLKEKYPQDVSG
IYQLVQGQLESRDMQTFHQQLPHLALRHDLDEAGKQTLCDSLQNKLVAMQSKLKVNCASK
RTLSRKRRASDDPTPSASPKPPSKNPLNLAYNYTPMYSAIFNIWLWLIVVIVLSVYVISL
VLWYMDPGRDSIIYRMTSQRVKTD
Download sequence
Identical sequences A7SQ62
45351.JGI246709 jgi|Nemve1|246709|estExt_fgenesh1_pg.C_2350017 XP_001626271.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]