SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|88259|e_gw.18.287.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|88259|e_gw.18.287.1
Domain Number 1 Region: 8-102
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000000122
Family MgtE N-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 70-169
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000111
Family MgtE N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|88259|e_gw.18.287.1
Sequence length 173
Sequence
MGPGTRGELLAVMGPGTRGELLTVMGPGTRGELPTVMGPGTRGELLTVMGPGTRGELLTV
MGPGTRGELLTVMGPGTRGELLTVMGPGTRGELLTVMGPGTRGELLTVMGPGTRGELLTG
SAIWQWGELLMLMGPGTWGELLTVMGPGTRGELLTVMGPGTRGELLTVMGPGT
Download sequence
Identical sequences A7RNX5
45351.JGI88259 XP_001638816.1.94760 jgi|Nemve1|88259|e_gw.18.287.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]