SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|99081|e_gw.52.312.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|99081|e_gw.52.312.1
Domain Number 1 Region: 1-55
Classification Level Classification E-value
Superfamily PGBD-like 0.000000811
Family Peptidoglycan binding domain, PGBD 0.054
Further Details:      
 
Domain Number 2 Region: 130-229
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 0.0000445
Family L,D-transpeptidase catalytic domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|99081|e_gw.52.312.1
Sequence length 260
Sequence
GKDVTILQNLLLRSKYVDPIGTSGAYDKPTSKAVAQFQQGNKLNSTPGVFDIATASLVLK
QLMYDGYHDDGTIPKGYKFKLYIPVYADRTKETNATLYDNQHKPIYTFIVRCHGSMDLET
GMAVNQLTTNGNTPTGLMSFDLNSPEPNHKSFGPFPVVRAVEGIKGNAAIGRDAENTFLP
YYRDGLLLHTGEWANWNASMPMPNSNGCIHAHPADLKRVDDILTHDLGVAVRPNPFKGIS
YPYKPQGLLSIEQLDGRIKS
Download sequence
Identical sequences A7RZY3
45351.JGI99081 jgi|Nemve1|99081|e_gw.52.312.1 XP_001635089.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]