SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|111113|e_gw.104.13.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|111113|e_gw.104.13.1
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily PapD-like 1.47e-41
Family MSP-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|111113|e_gw.104.13.1
Sequence length 129
Sequence
MAKQEQVLKLDPAIELKFRGPFTEVVTSSLRLANPSEKRVCFKVKTTAPKRYCVRPNSGI
VEPNGAVEVAVMLQPFEYDPKEKAKHKFMVQTMFAPDNITDQENLWREADANTLMDSKLK
CVFELPADN
Download sequence
Identical sequences A7SAN7
45351.JGI111113 jgi|Nemve1|111113|e_gw.104.13.1 XP_001631314.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]