SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|212490|fgenesh1_pg.scaffold_157000009 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|212490|fgenesh1_pg.scaffold_157000009
Domain Number 1 Region: 354-456
Classification Level Classification E-value
Superfamily TAFH domain-like 2.22e-29
Family TAFH domain-like 0.00027
Further Details:      
 
Domain Number 2 Region: 651-688
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000121
Family TBP-associated factors, TAFs 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|212490|fgenesh1_pg.scaffold_157000009
Sequence length 969
Sequence
MASSFLEDLLEKKIDENEVSAMKGSLESQLASPANGKSAQNEVKQDAGPNKSTTQQAVIT
TSPAKQGSPASNQAASLRPGIPASRGLSPGNPVTTTVIHIAPRPSVTAAVPLAPRPNTMT
VLSQGADGRYITTMINAADLINRNVNVINASQLLGPRMVAGAVTVPGTGQILAPRIIQQL
PQRIGVPMAHSPSLQGVQISQDNTTGMLTLTQAPGRPVISVQSSIAGQQNIPLDRTSIAQ
IRPSTVTMAGTTQFSGPRPMHVIANQHPPAPVSQLQSNSNNASAARAITTSSNPSISTSV
LQGNLSTNARNTASPKPVIVNSQAVSIGNSSSPAPQVQPQVKIVNTPIPIEVIKEHAAKL
KNFFNNLIRLASEKSPEVGPAVKDLIQKVMEGKLSEEDFAAKLLTTLNSGPQPNLVGFLK
KALPMLRHQAQLQALPQQQQPLQITTVGGPKLLPHPQTQVTPQKPTQTQQGTPIQQKVAA
SQPNIVKLTPAQQQLLHRQRQLEARRVFITASSTGGVSTVARGVAPGMVTAAGSKVTLTA
VKGQAGTAGAPKHKQHAGISSSGDDDINDVTSMAGVNLMEESQRILAINSELLSSQTRSC
RDELFLNHDALQKKLEVIAKIEKKIMKVMFVGYNGINGKGNNDGNNGFEVVGEVKKQGLG
NIHQDVCGLISHACQERLRNILEKLSTISLNRPESYRDDPRYEGGLETKAQLRVFEQIDE
VERKKRELREREVLMRAAKSRSRQEDPEQARLKEKAKQLQQEEEEIIRKREANNTALAAI
GPRKKRKLDEALEATRPSGQFPFDSEFNFVIAIVYLQLTTESFYAAFTEITASNAQGPRV
RTRAGEGIYEIAYALQGTSQIIARALTKRLRPSDESSRESNERPSKGDQQVATALQRPVW
RGYKMLPNDVRKDPEILTSMRREESHQVTNALLCPAQIVRRTCSRSRKAYEFYTSNFRES
YELPIYLRA
Download sequence
Identical sequences A7SHT6
XP_001628747.1.94760 jgi|Nemve1|212490|fgenesh1_pg.scaffold_157000009 45351.JGI212490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]