SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Nemve1|94473|e_gw.36.6.1 from Nematostella vectensis 1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Nemve1|94473|e_gw.36.6.1
Domain Number 1 Region: 482-498,619-708,777-840
Classification Level Classification E-value
Superfamily HAD-like 4.54e-28
Family Meta-cation ATPase, catalytic domain P 0.01
Further Details:      
 
Domain Number 2 Region: 166-238,378-481
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.14e-18
Family Calcium ATPase, transmembrane domain M 0.031
Further Details:      
 
Domain Number 3 Region: 289-385
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000000000955
Family Calcium ATPase, transduction domain A 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Nemve1|94473|e_gw.36.6.1
Sequence length 850
Sequence
MATGGSLTEEIDYVKLYNLRPLVFHLYLLPFIPLYGAWLYTWLMIYGVSEYFEAGLIAVA
IIGLLQILSGLFCHWNVHVRSFFTCASESNPSKAKIIKVVPTANNGSAELINLHHDKDKQ
TGKEIIWFNFQKAKYVYDSEEKKRFCPVQFPINKTMGHYQESKGYLDDTMVNQAQAKFGT
NELEMTVPDFMELFKERATAPFFVFQVFCVGLWCLDEYWYYSVFTLFMLIAFEATLVQQV
QWKLQGSNAGIYKLDITMATVGLALAQINSLDFLCVYLILGRPKNSDVLIPCDMLLLRGS
CIVDEAMLTGESVPQMKEPIEGLEAQEVFDMDVHGKLHLLSGGTKVVQHSPPPKTAAGIK
ASDNGCIAYVLQTGFNTSQGKLLRTILFGVKRVTANNLETFMFILFLLIFAVTAAVYVWV
KGTEDPNRNRYKLFLECTLILTSVVPPELPIELSLAVNSSLMALQKLGVYCTEPFRIPFA
GKVDVCCFDKTGTLTSDNLVVQGVAGISTKVGGVSPTPVITIGVFLTIDNHVLQGVAGLG
KRGVTLTVVDNHVVYYMGSPSQPYIRVELPKMLYLEAAVVLACQKLKRKIKCVYSITSNG
APETLRNIYEKVPDNYDAVYNKMTCQGSRVLALGYKKLGELGNKEMRDLGREEVESQLQF
VGFVVIACPLKMDSKNVIKQIQESSHHVTMITGDNPLTACHVAKELRLTKKPIIVLTPPV
YNHVNNHVDGDWHWEPADRSFSIPLSPSGGSRELINKYDMCITGEAFSYLTTHPEASKLF
DAILPFVRVFARVAPKQKELVITRLKSRGYVTLMCGDGTNDVGALKHAHCGVALLTGAPE
RLPESGKRSK
Download sequence
Identical sequences A7RV58
jgi|Nemve1|94473|e_gw.36.6.1 XP_001636788.1.94760 45351.JGI94473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]