SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Necha2|48270|e_gw1.27.383.1 from Nectria haematococca mpVI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Necha2|48270|e_gw1.27.383.1
Domain Number 1 Region: 18-329
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.16e-58
Family beta-Lactamase/D-ala carboxypeptidase 0.000000216
Further Details:      
 
Domain Number 2 Region: 439-534
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 4.18e-35
Family D-aminopeptidase, middle and C-terminal domains 0.00018
Further Details:      
 
Weak hits

Sequence:  jgi|Necha2|48270|e_gw1.27.383.1
Domain Number - Region: 353-428
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.000889
Family D-aminopeptidase, middle and C-terminal domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Necha2|48270|e_gw1.27.383.1
Sequence length 534
Sequence
MSVSEQLVQSVFKTIPPRLRGPGGAVAVVKDGHLLGQTVWGYADLDKRIPMTADTPMPIC
SISKQMTCAVLLDLERNPTLSMSKENIRGQFEAELKRLLRPEMTKDGKLSLEHLCDNRSG
IRDYWALTTLWGAKPEGRFDLDKDGPQARDLLRSFHFEPGTEYSYSNTNFHILARIIEKV
SGESFEVLLGERVFGPAGMKTARLCADTSKLPEPCVGYEGDEKRGYTPAVNRIEWDGDAG
IVASLSDMVAYEGYLDRSLSDPTSWYRTAIEPSQYSDGTPAVYRYGLSHVDVEGVETIGH
GGALRGFRSRRLQVPKERLSVVAMLNHESEAGTLAEHVLRGILNLQRPQFPVVAPTPDWF
GTFIDDRTFLAITVSPSVKGKVSIYYAGYAESITLTEPSRGVSRDMTATLTLDTLHIERL
KDHRTLRAVRVVQSDTPVDNAFYQGDFYCAEIDSTFHCYDQGGVMFGTFDGFLGEGPLQP
MRYVGGRVWTLSCPRGMDAPAPGDWTVVFDCKKEAVVGVGIGCWLARSLYFVKK
Download sequence
Identical sequences C7ZD61
XP_003043881.1.20327 jgi|Necha2|48270|e_gw1.27.383.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]