SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Necha2|65315|estExt_Genewise1Plus.C_sca_8_chr1_1_00764 from Nectria haematococca mpVI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Necha2|65315|estExt_Genewise1Plus.C_sca_8_chr1_1_00764
Domain Number 1 Region: 361-572
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000213
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 2 Region: 104-342
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000183
Family Tropomyosin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Necha2|65315|estExt_Genewise1Plus.C_sca_8_chr1_1_00764
Sequence length 719
Sequence
MGGVISSFSGSSGEDSIAARQALEKKLADREETISVLEEDLSKKEKECTTVSQDVEELRK
KIKELEAQSSSALDETHARIAILQDELKKGGDTSSEQLRNTKEAASKSAQDLDAAKAELV
ALEDKLNTVEQEKQSIVDQLAALKAELAEVKEAREALESALNKEISTLKAQITEAEEKNQ
TLQQAHSKLEGDLTAASSAADEGKKALTGTEEKYTTLQQTHDKLETDLAAAVSALDEQKK
ALAGSEEKYTTLQQSLDKLKEESDAQLSSAKTDLAQAEEKTAALQQTHDKLKTDSESELS
SLKAQLAELSELQTKHAALEQTNQALEKELAELKEKVASLEKNNEALKSDSSAGLVAAQK
EAAEWQEKHSALQTTHDGLSSDLEAVKKQLADSEEAQKKSSEEQAALEKKLEEQEAKLND
VEKQAEEAKANATKVEEDLKASQAEKEALQAKIAGLESDSQTSKESESGLKTKLEEAEAK
VTSLEADAAKAKETESELKAQVEAAQAKVTSLEAEVQQAKDAEAALKTKVEEAEAKAASL
ESELQKAKDAEAELETKVEEAEAKIATLEADAQKSTDAESGLKTKLEEAQATEADLKSKL
EEAQAGQTSAQTEKEEALEKAAEAAEKVKALEAEKTSADEKATALEKEKTDAEEKTKAAQ
SAFTSALEKVKAIQAEKKEAVEKSEASAKETADALEKIKALEAELTELKAKQTNGTAEA
Download sequence
Identical sequences C7YWL6
XP_003049916.1.20327 jgi|Necha2|65315|estExt_Genewise1Plus.C_sca_8_chr1_1_00764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]