SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Necha2|102997|estExt_fgenesh1_pm.C_sca_8_chr1_1_00218 from Nectria haematococca mpVI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Necha2|102997|estExt_fgenesh1_pm.C_sca_8_chr1_1_00218
Domain Number 1 Region: 185-345
Classification Level Classification E-value
Superfamily E set domains 0.000063
Family Arrestin/Vps26-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Necha2|102997|estExt_fgenesh1_pm.C_sca_8_chr1_1_00218
Sequence length 403
Sequence
MSAPASVRVSGPPNSSFLVGYPGISATLPRIEGKVEIRPGQGYSMPVPISLVRICLQRRE
TIHPDADSLAKRHLGAPRRETTDLVGKEQLLFRCASGREAEKVIAMDLPFVLFIPYGRGG
EESNRRIPPASLQLPSRTAETYYELVVTVQQGHSNQYKYSFPIPLLRYDTLSTFGMYNKP
ESKLVTNDNIVHLGINLPRWSYGPSDPITVYIKLSPNTDWLHKAKRVTIDKITLTIEEEI
TYNPEGDEPSKKVNKISRQVQVVKTKIPEAGYATNIGLNFPSKDLRDPDGIIKRGKPQFP
LYEVTSFTTTSTLYKIEFYLSIKVNLSGARDVTLRQPIVICPLDQQACKEEMDAIEQAAK
EASHVDPNNPMLPAQTIILANDRDSLRALGLCMVGGQKKPFIE
Download sequence
Identical sequences C7YWE8
XP_003049659.1.20327 jgi|Necha2|102997|estExt_fgenesh1_pm.C_sca_8_chr1_1_00218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]