SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Necha2|32116|e_gw1.1.1370.1 from Nectria haematococca mpVI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Necha2|32116|e_gw1.1.1370.1
Domain Number 1 Region: 91-238
Classification Level Classification E-value
Superfamily E set domains 0.00000168
Family Arrestin/Vps26-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Necha2|32116|e_gw1.1.1370.1
Sequence length 859
Sequence
MPSAPHLGMGRRSKSSPSLANPTSAPGTAASNSSNVASSSPVGSAGSSTPPAPRATSPTA
STTSSTRPSFLSRLSLPLSLRNRNRNVADFHIRAEEPHRRYGAGDHVRGAVVLVIVKPVR
ITHLTVSLHGYVRVLKDPAAVAKAQGSIVMPQNGDSARPRYHGNGLASLFQDEQVLSGEG
RLEPGRYEFGFNLVFPEKGLPSSIDFERGTVSYMVTATLTRPTSIAPTSSCERKVMLVEN
VDIGSLQAPRPRTIFLEPISKRTRRKKSMMLDKASAAPSEVNELGSEPDPVETPTEETRE
HAVDARSPIQSDMRSEVSGESGVSGSTGVSRPDLTLSQVGTLTSAKQQAVDKKTITATIE
LIKGGCLPGDAVSVRVTVQHIKRIKSMTGVIVTLFRQGKIDSNPPPGLFDGSLSREDVAQ
MDKDEVFPRSRTGLGGLTLISSGSTSIFRKDLDQNIAPLIIDPSTMQTSVTVTVKLPDDS
FPTIKGVPGEMISFKYLVEVVVDLGGRLSNQMQTGPASRFGSYGHGNSDNYTYGPRRGAN
IADTSQLRHEKGVISVAIETVVGTTDTSRGRKRSRASPTSRRNRAPESDDEEAAGRDSSH
GDEGPLETHQNNGQLSPGGYFPSQQNGNRHPPPIPSHPPQPYSQVVPLQPPSQPPPSHPG
YTHAQTNGSVHPPTAPAYIPPPEIPNQSNLSEKDRIRQAETRLLPSQPPEAGPSTSNEDD
NIYDAEDTPNASNLPADSAPSAPSAPNAPEAGPSAPTEDDIEVAAAPPSQAVEDKQEMER
RRLMQEASAPPEFPEDMDRRNGGPSGETAPDPEPEPEPSAPSAPVLDDFDNDFPGYGSGA
GPSGSSRHGDGEQLPAYQR
Download sequence
Identical sequences C7YGS7
XP_003053506.1.20327 jgi|Necha2|32116|e_gw1.1.1370.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]