SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Necha2|35408|e_gw1.2.1228.1 from Nectria haematococca mpVI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Necha2|35408|e_gw1.2.1228.1
Domain Number 1 Region: 21-356
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.04e-73
Family NagZ-like 0.0000565
Further Details:      
 
Domain Number 2 Region: 575-721
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000145
Family N-acetyl transferase, NAT 0.033
Further Details:      
 
Weak hits

Sequence:  jgi|Necha2|35408|e_gw1.2.1228.1
Domain Number - Region: 525-589
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 0.0641
Family Beta-D-glucan exohydrolase, C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Necha2|35408|e_gw1.2.1228.1
Sequence length 946
Sequence
MAHSNDDADLDPIWQDLDRAIGQILIMGWDGTEVTPQIRSLIEDHHLGSIILTAKNLKSA
QQTAELVQELQTIAKNAGHPQPLLIALDQENGGVNSLFDEDYVCQFPSAMGVAATGRADL
AYEVTKATATEISACGVNLMLGPVLDVLNNARYQPLGVRATGDDPQEVSQYGLAALRGIR
DAGIASCGKHFPSYGNLDFLGSNLDVPIITQTLEELSISALVPFRNAIGSGKLDAMFIGG
CGISNPSMSVSHACLSDQVVDDLLRDELGFNGVAISECLEMEALSHELGVQNGVVMAVEA
GCDLVLLCRAYDVQLEAIKGLKLGYENGIITKERIFTSLRRVLQLKSTCTSWNKALNPPG
ISLLSQLHPSHLALSLRAYDDSITVIRDKEKLLPLSASMHPGEELLLLTPLVKPLPASSL
TKKLLSTKGDQSQAWGSHHIWAHNDRDRSAIMSGEGVFREFGKSLARARNEKLLHTSYTA
NGVRPVHENLIHRASCIIIVTADANRNLYQAGFTKHVDMMCAMLRSRGQKKQLIVVAVSS
PYDFAMDKSIGTYLCTFDFTENALHALARALVGDITPLGTLPGTLRKSKKVLKSRQHWLV
EEYHTDRDASGLEDLIRAIHRASAPDLQFLRTTTAATFQLKNPNIAEAHVVVRNSSTGAL
YGFAATYFLHGVGILAAIFVDPSKRDVSIGRSLHRRALRSLMQRRGIKKVQLGSAFPGVF
LGIPVDIEVNTVKEWFSNSGWDVQFPRRVTNMIIQDLPNWSAPEGLLQSIQRANISFDLI
HGLDNGDGVLSHVRTHANAEILELYRYALSDNKSCGIVRAKDATGNLLGTIIISKQHGSL
ATHVPALLSHTEDISGILAPIVPAMPQSNLVLQGLALMGVRQSKGHKAAKVVLGWVVDDG
TEPLAAMGFESLQAFEEITNSPENVSNKPDLYLKHYLIMQQFSNLG
Download sequence
Identical sequences C7YM58
XP_003053110.1.20327 jgi|Necha2|35408|e_gw1.2.1228.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]