SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Necha2|36175|e_gw1.2.1632.1 from Nectria haematococca mpVI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Necha2|36175|e_gw1.2.1632.1
Domain Number 1 Region: 64-224
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000112
Family N-acetyl transferase, NAT 0.0054
Further Details:      
 
Weak hits

Sequence:  jgi|Necha2|36175|e_gw1.2.1632.1
Domain Number - Region: 35-43
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00068
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Necha2|36175|e_gw1.2.1632.1
Sequence length 359
Sequence
MSLPSTKPAQLSIRSFFQAKTPKYAPPPSAALSTPPPPPPPPPAASAPPPAVSPPSEQEQ
ADETSTFELPPLPTSLPPEADIRLVSPSDINALRRINALLLPVSYPDNFYQRAVDPAASG
RFSRVITWAHDDAEPKVVGGVVCRIEPILDSKTHGQVPQNLYIQSLCLLSPYRSLGLINA
AVDNIISTAVSDSSLDVASVTAHVWTENEEGLKWYEGRGFKKDDQPIRGYYLKLRPDSAW
LVHRPVGASVRSSLPSSSSSAVPPSIPASTTAAVVNLPPMSGPPKDGASRPPLPPSGRSY
QNSRPETEWNDMPEDMVGGLLVPPGRKPLRETGSGASSRSSSTARKKRDRSYPAAAFGS
Download sequence
Identical sequences C7YM01
jgi|Necha2|36175|e_gw1.2.1632.1 XP_003052572.1.20327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]