SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Necha2|79465|fgenesh1_pg.sca_3_chr4_2_0000866 from Nectria haematococca mpVI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Necha2|79465|fgenesh1_pg.sca_3_chr4_2_0000866
Domain Number 1 Region: 280-357,385-439
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000192
Family N-acetyl transferase, NAT 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Necha2|79465|fgenesh1_pg.sca_3_chr4_2_0000866
Sequence length 541
Sequence
MYRPSGGQKGEIPDATSTSSVSRTLQQFRAQSGGVPIRTETPPRLWPTAVLRAGRDDGRS
PRSFAACRNPDTSISDQTPRQESEDHSSSETTNSPREASPDLSQGSPPGGVPLPAPLHII
HAATESQEKPNVGAGTLTMVVSEGQDQAAEIPSSVAHDNERSAELPRYEALSPGPFRLPA
VIAAVDKWQLDDWKPPVVAYLKLSRDPVMDQCDIDTDTGELMKPLKHIRIKTEDRTITHN
MGDPEWRRWNMTSEMYISRELTRREKLKEEVLDQLKQEEVSQLPEDEPWPDARCTLRPAV
PEDCAEIAQIVNLEIQKEGHSQILLPQPVTAEDIRAVYDACLRGLRPFIVAVPSQNEFLD
RSKWPKGAEEEYQEFLKFKKAQEPSKPTVILGFAFVTDTRQGFLGHMCPASRLTGQIKLA
VHPEHRRKLIGTALLDRILASVTIGHRSLVDFKWECSNPNSMYEYPADRNRRQYARVYVE
TFFTGEDDPSLVWMTGMLEKFDFKRVGLFKETAKRGTRGGEWLDLVVWELEVRSAEELAN
Y
Download sequence
Identical sequences C7YNY2
jgi|Necha2|79465|fgenesh1_pg.sca_3_chr4_2_0000866 XP_003052368.1.20327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]