SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Necha2|80108|fgenesh1_pg.sca_12_chr5_2_0000288 from Nectria haematococca mpVI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Necha2|80108|fgenesh1_pg.sca_12_chr5_2_0000288
Domain Number 1 Region: 190-284
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000279
Family N-acetyl transferase, NAT 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Necha2|80108|fgenesh1_pg.sca_12_chr5_2_0000288
Sequence length 502
Sequence
MVVPKRSASPLEGDVLKSTKKPSSRNSNSTTDSTETPADVPVGIIVSLRLDSKAKRNDPE
SNQHVDRRDDLADGSEDQPIQENPGTIQGDDDAEFEEEIKALSNLSGLPFLDDFAHLKWL
ERIDRLAILKRTRIGRCDAMLIRRLQIHHKFWTAMEEPTRQTSELAFELFDRYGRLRKEF
REHPVNKGTGVWGRELDGEDILLFESIRIEPGHRRQKIGTKLVNAVLNKARRKTTKFFAL
AKPRCLVDEFDDEDTEQRVVATEAAEQFFLSIGFRRVGTSGWFAFTDDTSHSSKRLETSD
DWNQPRLTQVPQSTVETFDRLRGPDMVDCECVRLLQTDLRLELEDNPGISLDEKENTILH
LFALRTWPKSIAYAIDKWPQLKNARNREGHTPLEALQRLLEMSRTTRIEKGKTHVVSDDF
RGFSPVQIASLGALEDVNVCDLDKVSKDIISRVFTTPKQEFQRIPGASEIQKTLRLKVNC
NWGLSGIRSTMAVYGSSGTEQN
Download sequence
Identical sequences C7Z143
jgi|Necha2|80108|fgenesh1_pg.sca_12_chr5_2_0000288 XP_003048013.1.20327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]