SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Necha2|89126|fgenesh1_pg.sca_99_unmapped000004 from Nectria haematococca mpVI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Necha2|89126|fgenesh1_pg.sca_99_unmapped000004
Domain Number 1 Region: 493-522,564-624
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000765
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Necha2|89126|fgenesh1_pg.sca_99_unmapped000004
Sequence length 679
Sequence
MKLFDTLKSDLKTDVTWNRAARLGASGARSLPSGTVQYLADKVPIIGWLPKYNPRWLVSD
LIAGLTLGLMLIPQGLSYAKIADIPVEYGLMSSWLPAVIYAFMGSTKDVSTGPTSLIGLL
TSENVHALQDRWTPSEIASATAFMMGIYGIVLGFLKLGFLLEFISLPVLSGFITAIAITI
ILNQMDSLLGEDNVGDGAARQIHDIFNELPNANGWACLIGFTGILFLTILDKSGKRWGKK
NRVIWLLSITRAFLALVLFTGVSYAVNKNRGEDFLFDVVKVQSKGQQAPRMPRKDLIPEI
AGRSIAVFIGSAVEHLAIARAFAVKNHYASDQSQELCYLGVTNFFNSFFHAMGVGGAMSR
TAVNSSCNVKSPLSGVVTMAVVLVCVYELVGTLYWIPKATLAAIIITAVWGLISPPSTFY
RYWKTSLADFISSMLALWVTLFVSSEVGIGCAVGFNIVYVLLRQVFTRLSSTGSDVESRA
GNLQRLGGASPHIPEDMRVFTFNESLFFPNAFRNTSKILDDIQTFHAPVYNGSHGLETER
NWSVVGEKRVARLRKQAGIDGVSSLPEIRVVVLDFTRVNMIDTTAVTHLRNMVAALKTYA
GDGLEIRFAGMSSQCRERFERANWHITKVGSDGEDAGDVSESTYLYWDTAAAITAPRRRD
SVLSNEGKVHAMHQEKADA
Download sequence
Identical sequences C7ZQA9
jgi|Necha2|89126|fgenesh1_pg.sca_99_unmapped000004 XP_003039500.1.20327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]