SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156542835|ref|XP_001599750.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156542835|ref|XP_001599750.1|
Domain Number 1 Region: 944-1238
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.23e-86
Family Complement components 0.0000158
Further Details:      
 
Domain Number 2 Region: 1317-1451
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 6.28e-32
Family Alpha-macroglobulin receptor domain 0.00084
Further Details:      
 
Domain Number 3 Region: 776-827
Classification Level Classification E-value
Superfamily E set domains 0.000000322
Family Arrestin/Vps26-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156542835|ref|XP_001599750.1|
Sequence length 1496
Comment PREDICTED: similar to tep3 [Nasonia vitripennis]
Sequence
MTTAKRTSPGKIPSQRWTGHLGPLLLLFCGLTSGQSRYYSIVAPRVVRPNSEYHVAVSIV
GVSEPTTTFVELSGQLDSGESFAVSENIIVEPYATRVLSLEIGDTGPGRYRLLARGISGY
EFVNSTELDYAHKSYSVFVQTDRSVYKPGSKIQFRCIVLDSRLRPTANRQLEIYITDGQG
NRIKQWERPRLHQGIFNGELELSQSPVLGDWEIVAEIGGQTFKKAIQVAEYVLPKFEVTI
DSPPHATFKEGKITVLVHAKYTYGKPVKGEATITAFPDIYSGVLQPIYSPPIRKTVNIDG
KTTVDFDIANDLKYDDDYKRPVVIEVAVEEAVTGRRQNNSMQITLHKHKYTMELLRTAEY
YKPGLKYTAFLKVTYHDGSPVVDNTNPVHISYGYTYNSEDLHNITRMLDKNGMVELDFYP
PLSMPDKIFRPLRIEAQYLNLHEWFPSTNPATSRSESYIQAMLRTDKPKVNEYVEIEVNS
THPLKYLSYQILGRGDVLNAASIQISDRYTATFKFLATYVMAPIAHVVVYYVREDSELVA
DSLDVELEGTLQNFVDIKPVSDEVGPGDNIDLTITAKPNSYVGLLGVDQRSLLLKSGNDI
TYDQVRKELMSYDVNDAAFYDQEDYEHSWIRPGSANADEVFRKTGTVVLTNGYVHKNPQL
TYPEEEGDRLKNPAQGISISTLRPDIGPPVKHRFATRPAWAGRYAFSYVPLLPWRPRVFL
MHDISDTWLFSNMSSGYEGKTVIRRTVPDTITSWVLTGFSVDPAFGLGLIEAPRKLRVFK
PFFLSMNLPYSVIRGEIVAIPIVVFNYMSKDLNVEVVLENNGDFEFAEVSNEVHDNTKRL
ELYRTKKIFVKANSAESVAFMIVPTKLNHITIKAKATSVMAGDSVEYPLLVKAEGETQYR
NKVVFVDLRDTDSMKTNVTVDIPKHFVSDSEYVEVSAVGDILGPSIPNLSKLIKMPFGCG
EQNMLNFVPNIVILDYLKNTNQLSPAIESKSIRYLETGYQQELTYRHTDGSFSAFGKTDP
SGSTWLTAFVAKSFKQAEKYITVEEKIIADALKWLAEKQAPNGSFPEVGTVSHRDMQGGA
AKGLALTAYVLSAFLEVENIEGRYRNVIYKGVDYVVRNMQGIDDNYALSICTYVLSLARN
AYEDEAFRLLDSKATTKDEQKWWSKPIPEDDKKNPWFSLSRTVDVEMTSYALLAYLRRNQ
LSDAAAIMKWLVKQRNAEGGFASTQDTVVGLYALAKLGEKLRTNVYDVQVRITTDVGESK
EININSRNFMIVQKHLLLSRTRAINITATGTGFALVQVASRYNLNVTGAFPLFTLDPQVD
KISTNDHLQLSICSGFIPTKEANESNMAVMEVSFPSGFTVDQDALPSLELSQNVKRVETK
NGDTMVVLYFDKMVHDKSYCPTVSAYRTHKVAKQKPVPVSIYDYYDSSRRARVFYEPKMT
TLCDICEDEQCGDVCSIKAGKREDGTLPSVSSSSTTLGNFALILACAYYIALNSRR
Download sequence
Identical sequences K7IPL4
gi|156542835|ref|XP_001599750.1| 7425.XP_001599750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]