SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156544113|ref|XP_001605722.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156544113|ref|XP_001605722.1|
Domain Number 1 Region: 409-505
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.38e-23
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 2 Region: 1004-1108
Classification Level Classification E-value
Superfamily PDZ domain-like 9.99e-23
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 3 Region: 532-644
Classification Level Classification E-value
Superfamily SMAD/FHA domain 9.67e-21
Family FHA domain 0.000099
Further Details:      
 
Domain Number 4 Region: 210-302
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.63e-18
Family Ras-binding domain, RBD 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156544113|ref|XP_001605722.1|
Sequence length 2836
Comment PREDICTED: similar to CG2534-PB [Nasonia vitripennis]
Sequence
MTSIRAELKVIGSYRFGRLSTNNDLDVIYCLYQVVMSNPDDKVKIFDKMQRQSFVEITRK
RCLNSKGEFGKLLLPWIAIAERAIDPSSLLLSPTCSTHCGGSVEQKQVQLIEWLLDKGVE
VNVVDEHGRRQCFTRPTAEKPTSYCRPGRKCRRATEKFGESLLCTSRLMAAEAASKKAER
EALRGVIQQWNANRLDLFELSEPNEDLEFHGVMRFYFQDSGQKVATKCIRVASDATTQAV
IETLIEKFRPDMRMLSVPEYALYEIHENGEERKLGLEEKPLLVQLNWHIDDREGRFLLRR
IDDKTNAQGVGFAEASSFRRKLSKREKKQMKKQEKLSRLKSAGAASEQDENAAPLDQNGV
AEKLYTELPETSFTRSISNPEAVMRRRRQQKLERKLQQFRSKDGGPDTGGTLKIYGEALC
KDVPYKTLLLSIRDSAAQVVREMLAKYGLEKVDPQQYCLVQVNGENANGNAHQEYILDDD
ECPLAILMNHPSTRGSIMFHVRRRPADYVPRKRKKKPAGKWNELEHIRYEDERLPFLLEL
NPDGTDISSGAGVRHRLQPNVTEVGSERPIGPQAVQAQTLTLTGPTVMPRHCVIAFTENI
VTLTPCSRDAHTYVNNQRIHQTTILQNGAIIKFGRMHTFRFIDPAPEERIRQRHDSGRQM
DYSYDRYRASTHYRPELQPTERAKRLTVMLANVATMIQRVIQERYMDASSLALWLANGSE
LLHMLKSDRHVGAFSTQAQDILADAVHTAFDSLVRCVSLELAPAMSQFMADADEPAKEAG
VLQIFSNSMALLRRCRVNAALTIQLFSHLFHAINATAFNALVSNSNLCVRWFGRRLKARL
NALETWAERQGLELASQCHLATIMQATHLLQAPKYNTEELAALSATCFKLNSLQVQALLQ
KYQPAADEPRLPAELIESAVRTAMKVADGLAKQDGREIRLEEEPTLNLALLLPDDGYSCE
VIRGVPPGLAEFLAPLQRDGLCRMAAQPTSSGYWTIYMIDHNNVSSSLFSVRLFQPEIQI
IKLHKSTSGMGLSIVAAKGAGQDRLGIYIKSVVAGGAADADGRLSAGDQLLKVDGQSLVG
ITQEKAAEYLVRTGPIVTLEVAKQGAIYHGLATLLSQPSPIMTRASKARPKSEHFDPPRI
GEMAPGQPGLFLALNGQSPPGASIARVGNNIAPQYRANANMPYRNYIPAAANSPYQAYQQ
LAPVARPNTLLTAGGAMMRGHDVAAEVYPNPEMPYEPAQVHANPSTARHLPPPKQYQEEE
PAAAAATSSNYGAQYGYYSDDKTELVFPAVRSHSQDYLEAVDDLQAAARTRTAVHQEQDY
YAYRNTDQPTNTQEQCQESCQEAAAAIAEQEELDEEDKSADKACSTEDATQSSTRDNSDS
PSLDTEATVVPTPKLHTVMPELNLDLSGLNSSDVSSDESNGEKCWKSPEDVRLGCGRVAA
LAKHFSQLGEAGLIKFKSRRFAGSRQFMSEPDIASPSSADTKRRTRASIEKFKSETELLK
SDKSVATTPEKEWSMILLDIQAKGTLEYQEEAENRKRESKEEESEKEEEEVEEDEGKVKE
ADDKSSSKLSLAEQEQIIEQLKEFANLDNVDAPLFIPSKENGNSRRGSGSDKETMTDSTE
GSIENIHKVKKQPRTLIAGSVKLEQFRNHSLPTILSTLNVFPQRRCNGSSATTIVAKGKV
NSLSKYWSLKDLASSDELDSNHTSNDDMLDDDDREDSPGANKYVVFPTCSRVVSAPEISD
DFARYTPVTGITIKSTISFGRRRSDESATASSTSSFHSTVRLSKSTSDISRDAIDGSIPG
DCDDDDDDRLSKSWEKLNLTCNKKHSRCYARRDNRGHGRRGNSKLVVVRKKAKSDLDVSE
RKPTPRFERGDWVFRDISQSIPVAAKREEPRQQQRTESRKPAMMFLSLRALVFVRVAHDY
VGTEGKLQHEVFNPGYSRASSSNSVTPPVQPPPMPAMNGATSLRSRSSHNLHDPSRAGTL
PPSGLSNRQQSSPNLNPSHPHGANNMQSNEAERFYQNLSVYRNQEPGLKQHPSPPQSSDD
RSPLHVQKPLSRGSESTLHRGSSEQGKERPMSAYVPQGQQPQQPGYPGPQGQQQGPPARS
QSSRDIIRQEAKLSEMQEEVRRRELRGGPAPAAMGAQGMAAYRNNTYNPRAGAGASGMQA
PNSIRNATQRPIGSTPNLGPTSPSYVHSRGPGQNYGYLPMEAQQQQYNQYAQQFNKPYTA
GMVGRPFAELQQQYQSEVEAELAAARYGNGNGMNRSQTNGDIANENPPARPSLPQSSGSP
PPPVPNTMTHPLFTKQMDPSSSSRYTASMQDPPRGGYYPTTAGGSQQPRQYQFSATNPWQ
REEKEKQQARRREAARQWRDQQIAELSALPHRSPQQEEQLRALQLERDFQKRAEEAANQQ
DDDEEGNDVDNENASTSQRIQGLLRSVAAQDQQRNQPNNQVPQPGPGLNRSNATNQSGRG
ALSPQPVGSQIQMTNVPIHTASSQQGTMQNNYGGGQNVDAMANNVGGYSPQNQNVNNSQS
TMSPSYGSPNLNQQSSARQKASMEAAAAAQANEERERQRRMEELKRRQSEFDENQRRRQE
EEARQQQQQQQQQQMHAHQQQMQQMYQQHQSNLRNQHQLHPGMLRLDNLVIEEPNSPNSQ
SGNEAPPPPERGSSYAVMSQQSALRSNTSTTSNSILGSQPPATMTKRVSFHDPNANTESP
SRNNMSNTSNIVTPSSVTMDTIREDPNNFINDAEMLLASPKTPEGPGGIFQGATPGVIGA
QEVYKDPRTRRLAEKQRQQQNSQIGAVPEKLSFKEKMKMFAMETGEDGTPRDKVKISRAQ
REIDNIGSPLSSNNNN
Download sequence
Identical sequences K7IRG2
7425.XP_001605722 gi|156544113|ref|XP_001605722.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]