SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156551435|ref|XP_001604367.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156551435|ref|XP_001604367.1|
Domain Number 1 Region: 1409-1662
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000425
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number 2 Region: 57-209
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00000523
Family HBL-like 0.031
Further Details:      
 
Domain Number 3 Region: 1106-1334
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000471
Family Tropomyosin 0.00067
Further Details:      
 
Weak hits

Sequence:  gi|156551435|ref|XP_001604367.1|
Domain Number - Region: 457-558
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000314
Family Myosin rod fragments 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156551435|ref|XP_001604367.1|
Sequence length 1964
Comment PREDICTED: similar to ENSANGP00000000794 [Nasonia vitripennis]
Sequence
MNRRRPTTAKGSTKAKEYTGKPKTGKAETSRKESAEAGDEETEENFSSDALIKQNYELRH
RLEEEAAGFKKRIDAYRQAQQHQAELVSRLQAKVYQYKKRCSELESQMAESLPAEEDRLL
TGSLPGQLILQAAHQTMREMREEQIEDLDTALKKLAEERNRCEKLLQLNVSLKEQLEESH
RTNDALTSDLQKISSEWDALREEMSTKEEEWKEEEMAFNEYYNSEHNRLRNLWRDVHSVK
RLFADMKFATERDLSKMRGEMSGLANDTLTACSSTSFFLKLQAAANAASSSIVRSAQPQF
QAEKSQAASEEAAAKLEQALAEVRSRDERIQQLLREVQALEEKCSEAEASSGQRLRLQED
IDILQSALRDIAHAVIQDAETREIDANIPATHLHLSPSAPIPSSSLKRPKQRGSAIPAFA
ESTISAVQAALHKYQLTIHELEVKLQTHVEQLVISRKQAEGLEERVVILEEKNADIVVQL
DSMRSRSLQLSQERDMLQKALDNVRSEKQSLDKNCVEYTGVIDNLRAEYERIDKLNVKLE
KLCRNLEEEKYLLQQEVDRLSKDCEDRESTLRIEEDRKRELKEELLSLREDLNKACLAKD
MLEQQKFEADNYLSQAEKGKADLELELERVTLDKSDLQEVLSKWQAVCLNHEQDLTRLQE
ELKKCNEEKNQLVSQSADQQGDLTSLRKELLQAEQTRLDLESEKVTMHEKLKFLENEKEK
VEMDLAQVSRERGDLSNQLSALRRKRESLNEEFMRAKQRLEHNNEMMGRLNRDIQMLIKE
NEEKQVLLDSSEKEIQRHQEMLASIHSEKENLEATLFDTQGNLENTHQRKVQLEKEQQEL
LIKQESLNGQIQRLTKELENSEKHVRDVQQKLTQVIENQEVEYQTAIANLKKQSEEAIRN
LNEEKEQTRITLEKKLQQNVSQLGNEKEQEINQLQQRIEELQHHMENMREEQEGLLFRAE
NEKQKALLIVQQDLQALLVKYENVCRELEGEKGTLERVRREAAAHAEQDRSNLNKTRDEL
NRIKNKMEEAKLRADEEKLKLELKMEEIRNEKENALKVCEELQIQLHMTEDKVDELQNQV
QENCRKLKEAEITIETSRKELVDLRRQLTDSNFEKEKYNSTNKDLRERIKQIETERREQA
RTLEDSYQKIAGLEDAKTSLEADRNRLQNNLRETEREALQLQQQLRMTQEELEKSHNANS
QAQNNEKELEGRLANEIEERERVQLQLHQMKKKAVDLEGSLELIRQELAKTRARMSEEDE
RFRDCEQKLKHQLEEARCREHKLKEEVHNSEVCLADAIQQLQELKARLGGSEGRVRALEV
QLMQLEGQKKEVEQRLSSIVMILRRIAGIQLDGSVSVPFKLSSPTRRYSPVRSHEHGDGN
REVILDVDPEAVRRGVKSLMQQVAQIEREREDLKSELSITKKQLIEAQDNQTNVNSKLKN
VHAQVRSLQDEKNNLETKLMQKQTLLQAQTEKLEDKSAECDRFREKVIGLEMTVSSGCED
KLQYEDKMDKMKQTINKLDSEKRILKEDLAKSEHRATQLEVHQLSLEGDLQRLQMVIADR
EASLQKAQERCESQARTLISLEERCSSLKSTIEQLNGALEKGSVTESEMKAEINHLHRSL
IEVNAHSQSDTDKIKQLQKQLSSAESERRVITERLENLQQALSDLRHANQMLTDQNTRLQ
NELANCEVLRSGLESQLRLSNWPRDSSSSSDNREEELLRQLATAQRERSEFKAKVDSLSD
KVKSLENDKRNLERQLSSVRSSNMRSKSYERQEKAHSELIGSNFGAEHYEQEIRDLRLKI
RRLECELSDRDSEIVRLKTQASHSHAHTMMDRNVEVERYRAAQLQAEKLLEAREQSHRQQ
VIRLESQIHSLREQLNQEIKRRQLYVLRSSRAGREMQHIRQALGDSLRTVAQEPSLDAVL
LEHEARKLDCTVSHSSHASLPGSLALPAPTSHLDRRSPIPSSIK
Download sequence
Identical sequences K7J1S2
7425.XP_001604367 gi|156551435|ref|XP_001604367.1| XP_008216385.1.61660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]