SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156555075|ref|XP_001604193.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156555075|ref|XP_001604193.1|
Domain Number 1 Region: 1083-1382
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.36e-83
Family Complement components 0.0000144
Further Details:      
 
Domain Number 2 Region: 1454-1590
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 5.62e-33
Family Alpha-macroglobulin receptor domain 0.00058
Further Details:      
 
Domain Number 3 Region: 907-1026
Classification Level Classification E-value
Superfamily E set domains 0.000000000574
Family SVA-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156555075|ref|XP_001604193.1|
Sequence length 1887
Comment PREDICTED: similar to alpha-2-macroglobulin precursor splice variant 1; TAM [Nasonia vitripennis]
Sequence
MRRDLSIVLCLAALSCAAGLNRNRGYIFTAPKRLIAGETENVCLSLHNLESPVHVSVDLL
ATSSAAGPVTPASAGGALVEDDILGSAKNTLKSGVETCLELRVTSSTKYSAAKLRLRLKF
DKHPDYVVDTEKKVFIEHDALVTFVETDKAIYKPGQDVNIRILTLRHDLKPWIKAIPKVW
IENPSEVRVAQWTNVTTENGMAQLTFPLSTEPSSGIWRIKVEKNRPQLVHTSTFEVRKYV
LPRFQVTIGAPSYILADAPNATWKVCVRYSYGEPVKGKLLLSLRPQTPIWKRKQTVADIN
YEETLDAKSDGCMNYTVSAQVLGLPHWKVAPNNVVLLANFTEAKSGVVETATSRSPVMHQ
PLKLEFSPHTLKYFKPGLPYHGKLRVLRADASSPAPNEKIQVCLRIRRKDEWQRSVVECR
NFTSSNADGFLDFIVPPQNKNIVLLSFVATAVNYPTKYYSPDKRWRVFVDQPSAYIDVEP
WYSPSSSYLSVTRGSQPLVCGEKYSFNVMYTSGTSSTVNATNLSPDDTEPISFHYSINSK
GDLLVFGHVKYKPRKDTLLDYSEFRHVLGAGAGSKPNPSVHRFPLSVKITASMAPVSELL
LYYVRPDGEVVTASHSIEVGHCFENKVKTAWQQEKQSPGSLAKFHVEATPLSLCGISAVD
KSTRFLTQSQPVSSEGGSAASTGSNLLEPEATFARLKPFHLPPETMPMQSTWAHCDKSQG
AEDSNSDEGPMEEIDHLPKPAARNKRHSVTYNVAANYVDAIQAFDDFGTIVMSDLILESR
PCPPWRSSFGRVPLGPSSDEIDEPDRMLKAVKAMPLAFQFGAPGIPGPEASPMGQDVNYV
NPTSMESQTSTIVRSYFPETWIWELVPTGKDGRATIERQLPDSITDWIGNTVCISSKSGL
GIGNPVQITSFQPFFLDYSLPYSVKRGEQLRLKVSLFNYMQHSLPVLIKLLDHEGLDLGF
NSSSEASYCLGPRDSIVHEFPLLPRELGEINVTVAAEVDKERAEACGAPTPLPDNRDEII
KPVLVKTEGFPVEISRSSFLCPRDFSDDTSLVWELELPRPEDEQVVEGSVSAYVSLIGDV
LGPALENLEQLVRLPMGCGEQNMILFVPNIHAIAYLDAINRQTGSEMRARAIKNMQKGYQ
RELNYRHPDGSYSAFGAAADEAGSGSMWLTAFVVKSFAQARSIIQIDERDLKLSVKWIVR
RQLENGCFPVVGQVFHKDMKGGLREEDGSSSALTAYVLIALLESGVPLSAALVNNALYCL
EKASVSDHFADNPYTGALTTYALALLEHPRANESLRSLMGRASRQKDLLWWEDKSRPGSL
ALSIEMTSYGLLSLIKLGGENNTLEALRVVRWLSKKRNAEGGFSSTQDTVLGLEALTKYA
LKMANASATELSVLLTANDMEKLFKINDENRMLLNRVELPTLPTTLEIFAEGEGCLLVQS
SLRYHKAKASGSEAFDLSTSTASVSTADQTPNDGCSIQRLTVCTRYKLPDEESNMAVLEI
AMVSGFRPDRASLHDLLDEHATGVKRFEENDDTVAIYFDKLTAQKTCISFQAIRENVVDH
AEPANIKLYDYYQQELTVSTSYAFMDVCEKNKTEKAVINHEANSPAPRKMQQLDNRLSVN
QLPEKIDGIFEIDTTREKKVDPSIFKQRSSGVTIPATISIDLDEGSGIEPDGELFSPSPI
LPNIDQDVVDEGFSPAFINVDHELETPNGIEGPIPFYVEAPVSTTTKESVFAQTPLNAKP
SLNFHNSTKLKTEETKMSRSLASCPRCEEGIPSDIKELYCSSASAVKVAIRRSRKARLLL
DLSSSSASTRLRSTIELNIKPECPCAPLDKPGIMALLLSSKGGFNFAKSSDKSKALLDRS
NSMFALTSVIGTPHEIQEAQLSCSRNP
Download sequence
Identical sequences K7J5M6
XP_008210390.1.61660 XP_008210391.1.61660 XP_008210392.1.61660 XP_016838925.1.61660 7425.XP_001604193 gi|156555075|ref|XP_001604193.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]