SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156555881|ref|XP_001603577.1| from Nasonia vitripennis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156555881|ref|XP_001603577.1|
Domain Number 1 Region: 452-546
Classification Level Classification E-value
Superfamily TAFH domain-like 8.11e-31
Family TAFH domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 788-837
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000879
Family TBP-associated factors, TAFs 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156555881|ref|XP_001603577.1|
Sequence length 1000
Comment PREDICTED: similar to transcription initiation factor [Nasonia vitripennis]
Sequence
MASAKFLEEALSTDVDESAVSAIVGSLETQLVSGAQPNPQQQQQQQQQQQSAAAQSSNGA
PSSVVAAAAAAAATTPPLDGSSGPLQKPPQQHVANGTSNGDQQQQPQQPQQPQQQQQIPP
TVLATTTTPSTTTSSNMTAAAPPVQELAKPTPSGQPQPQQQQQQQQQVSTMQPSPQQQFV
PQQVAGNQSVAQLANGTLGVVTTQTVLQSTSNSAVSQVSAVSGQATAAATNQAQTINVNK
QTALVIKTSVAPTGMVSVPMSVPVTVAANITNTAQPGKAGVTSAIVPSNVQILNVNALRP
ATPQVAGQQPAKQVASRVVIGQHMMGGRAGTPGITLQTIQGLAQGGTQGHLLLKTENGQF
QLLRVGPANPNNAAVTPNSIAGSAAVVATPGATGTTYRLASLPAVSRLNAQFTGPPLATI
RKPIQTVAPTVTTTTVTAVTSTIVAATTTVNDNTKEKCRKFLANLLELSSREPKHVERSV
RTLIQELIDVKVEPEEFCIRLERLLNASPQPCLIGFLRKSLPLLRHALITKELVIDGIRP
PHPNSQMYIQASGFPAASPTVVTQQNQIRPTVAVSPAVTAATPVTHVPATVALTPPATTQ
VRVMAPLTGVTNVPRPPQPIQVQQKLIRPTTPIRPGLLATYSAKTPVIAAPVHHQIQSLS
TVVVSTSATSSTTGGSGATTTTIRQTTGPIIVQKTLPSTAVSKTVVASSHKTITTTTTLN
KAAVPSIQPKLVSKEKEKKTFSSAGYTGDDDINDVAAMGGVNLAEESQRILGSTKFVGTQ
IRSCKDEVFLHMTPLQQKINKIVSSYGLEEPNQEVASLISHAAQERLKNLVEKLAIIAEH
RIDLVKVDPRYEVTQDVRAQLKFLEELDRVERKRHEEQEREVLLKAAKSRAKTEDPEQAK
LKAKAKEMQRAEMEEARQREANQTALQAIGPRKKPKLDLGGSSASSPGGTAGLAGTGAGL
NRQMPLRPRLKRVNFRDLLFLLEQEKETCRSSTLYRSYLK
Download sequence
Identical sequences K7J713
7425.XP_001603577 gi|156555881|ref|XP_001603577.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]