SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ADAR001427-PA from Anopheles darlingi 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ADAR001427-PA
Domain Number 1 Region: 456-526,562-602
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.14e-17
Family Calcium ATPase, transduction domain A 0.012
Further Details:      
 
Domain Number 2 Region: 371-459,604-629
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000000562
Family Calcium ATPase, transmembrane domain M 0.024
Further Details:      
 
Domain Number 3 Region: 655-689
Classification Level Classification E-value
Superfamily HAD-like 0.0000437
Family Meta-cation ATPase, catalytic domain P 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ADAR001427-PA
Sequence length 762
Comment pep:novel supercontig:AdarC1:ADMH01003960:17484:25880:-1 gene:ADAR001427 transcript:ADAR001427-RA description:""
Sequence
MSRCSLFANHLLNIQQPGLPSAAIIVDHADSVQYRRTLRIMPISHATHADSVELEILEVR
HDSSDDLDLDEAAAALGGRRKLPKINRRQLPATGGGVSTAAGTQMPGVSVGRGVGMISPR
TGSPPRRKRFRRNRTSSRRKSNSQSCGSLYNLAAGAVQPIQLQRSEPNVNFYSSPGEHQQ
QQYGEATIDVNFHDVQDSSNTLDDAPVLESCESLGRSRSVGGGRTRCSSGATGHRINAGT
GELATGGGGEGIASGGSGRGGGILDDVDDDYEDELEERPMGRDGLEASSGHHRSAHGLRA
SIVSMLGRLGLWNTDKAGSKGPIILTRSETKSSFDRGQSYISNGATRLRSIFGENERRIR
ANDREYNTQFKYANNYIKTSKYSILTFLPLNLLEQFQRLANFYFICLLILQLIPAISSLT
PVTTAIPLIGVLMLTAIKDAYDDFQRHMSDSQVNNRRSKTLRHGKLVDERWSGVQVGDII
RMDNDQFVAADILLLSSSEPNGLCFIETAELDGETNLKCKQCLPETAAMAQQEDLLWKFN
GEIVCEPPNNLLNKFDGTLTWKNQRYPLDNDKILLRGCIIRNTQWCYGVVIFAGKDTKLM
QNSGKTKFKRTTIDRLLNFIIIGVIRFAQSFLINWDEKMYYDKSKTHAKARTTTLNEELG
QIQYIFSDKTGTLTQNIMTFNKCSIAGRAYGDVVDVRTGETVELSEVMEPVDFSFNPEYE
PEFRWYDQGLLDAVRSGEEHSHSFFRLLALCHTVMAEEKNGK
Download sequence
Identical sequences ADAR001427-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]