SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ADAR003694-PA from Anopheles darlingi 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ADAR003694-PA
Domain Number 1 Region: 441-542
Classification Level Classification E-value
Superfamily TAFH domain-like 1.31e-28
Family TAFH domain-like 0.00061
Further Details:      
 
Domain Number 2 Region: 937-986
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000023
Family TBP-associated factors, TAFs 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ADAR003694-PA
Sequence length 1301
Comment pep:novel supercontig:AdarC1:ADMH01003507:567:14438:1 gene:ADAR003694 transcript:ADAR003694-RA description:""
Sequence
MASANNFLEEALKSAVDESAVNAIVGTLENQLDVNTNLVQQVGSVGKSETGAGTGESGVK
IQSSAKHETAAASPKRDLVGGLANGEKIVVSNNNTITANNNTASKSVLPKPPPRNNSGSV
VIAGGGARGGGNINIISQQIVVPPPPFNVPPTSQKQLQTSSNMPKNEPVKLVYPANMNNN
RVTLTPGLSNGTITVSQPQPQSGNGGVSGPPTPTLIIKNQQTNAVMNPGTPGIVTVSKPM
NNQITLSALQGQQGSTLLLKNEQGQFQLLRIGPAPTGTQITPASLTPSSTNQTIRLQTVP
AVSRFTGPPLALRKTTATSTQQVKQKQNTHASGTGTIIVSSHSGTTTQTNYISTQPTPVA
SVAPVPALAAQQNITITHTSASPATVLSTQQQPQQQPQQQQQQHSSTGSVGGQQTSQQQQ
QQPTVVVTTTPAVTQQRNSLDNTKEKCSKFLTNLIELSKREPTKVEQNVRTLIQELVDAN
VDPAEFCERLERLLNASPQPCLIGFLKAQIRPVAPTIVSQGSMIGQTQIRMLTTQSGVTT
LPRIGQTTIRPAAPIRIQTPLQQQSTVASGGTTIVGQPRTTTLTAQQIRPNVTTIGHTTI
VQTAGQQLPQTISTTPPALLPVSGNAKFNASAQQQIRTPSGTSITRSGTTLQIRTTTPIT
SRTLTSIGGTTVTTTGKQILQSQSVNQIRGQTPVASVAAVAAAAAAAASGSSATQVKQVT
AITGGGNVVVSLNQNPPPMQPVSGLGGGSSQGGSLMVSGTQAMPALTLTSAASAAGFGVS
GGVVSGVKTASAVSSAIVLNSSSTVSTTAASASIGSGTAVSAGLPTASGTTLATPGLTTI
KTITAKSQNLSGAAAASAKKKASASAASSAGTEQDASKRAGASAQSQFYHHHAAMYGEDD
INDVAAMGGVNLAEETQRILGSTEFVGTQIRSCKDEVFLHLPVLQSRIRNIIARHGLEEP
SNEVAVLISHACQERLKNVVEKLAIIAEHRIDIIKVDPRYEVTKDVRGQIKFLEELDKAE
QKRHEEQEREMLMRAAKSRSKTEDPEQAKLKAKAKEMQRAEMEELRQRDANLTALQAIGP
RKKPKLEEGSSTSATDTSVEMETADAGATETEPHPRTIKVHMFCANDGASRTRFILVQLD
RTLIVVERSDPRTLVVHSRYDEFRQFSFVDHPHRPGACAVRIELDQQLEPIVTDFLGGPV
APGIELEARISCFDEVLKMLKQHTAERKVELRTAQLTVSQLFNDIHQPQKIVPDALRCSD
PEGMLPLVRYGEVWKRIHNDRLVIGVPLYNCTYESYVAIEE
Download sequence
Identical sequences ADAR003694-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]