SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ADAR008529-PA from Anopheles darlingi 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ADAR008529-PA
Domain Number 1 Region: 127-183
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000036
Family VPS37 C-terminal domain-like 0.019
Further Details:      
 
Weak hits

Sequence:  ADAR008529-PA
Domain Number - Region: 16-45
Classification Level Classification E-value
Superfamily PABC (PABP) domain 0.0288
Family PABC (PABP) domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ADAR008529-PA
Sequence length 463
Comment pep:novel supercontig:AdarC1:ADMH01002333:35529:37842:1 gene:ADAR008529 transcript:ADAR008529-RA description:""
Sequence
MYQPILHQAIQSLQTLSSEELRSLLDDDDKLDERVNEAVQSMEASKELVLSENRSLAEAN
LSHEPKMIELRSRVQELSEEGRNLGASVNEKVNELSKLPNTACEISTLIIGYLFNLGFDL
ESKSNKTNPETLLALLQTAAAETEEETEQLVKQFLDSEFTVDVFLEKFMGLRKLMHSRKL
KAEKMTELLQRRTTAVNSRVPPTGPSPYVQPFTGSPFSSPLQRNSGPSSSTFYLPPPTMA
GPSAGAVPYPKHQNTYAFKNNLHDKHTPLIKLITNLNVCEVCEHCKSVIDWKIKYRKYKP
LTQPKSCNKCGERKVKRAYHVICRDCALGSRCCAKCLKSADETKIIPPEPTPEEQVKLKA
EMDQLIKSLPERKRRTFLRYMNRGKKKPKDPEADEYDSDEGDDKKNAVSAHRTREELMQK
FEQLKLASGKDGDEDDLGDFSSGDEDYEDYSDDDLSSSLSEKK
Download sequence
Identical sequences ADAR008529-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]