SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ADAR009528-PA from Anopheles darlingi 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ADAR009528-PA
Domain Number 1 Region: 257-303
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000916
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.074
Further Details:      
 
Domain Number 2 Region: 436-538
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000012
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.045
Further Details:      
 
Domain Number 3 Region: 135-190
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000422
Family HLH, helix-loop-helix DNA-binding domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ADAR009528-PA
Sequence length 1390
Comment pep:novel supercontig:AdarC1:ADMH01001362:19571:30596:-1 gene:ADAR009528 transcript:ADAR009528-RA description:""
Sequence
MMGLGPCELPLPDQWLIHTQLAPSTPQASFFSSQSLGGGGGLVSGLSAATLPLQQHSSSG
GVTGTSNGGVGVGGNGGGILLQQQQQQSPANQHQISSTPSQPSNASAATTAGSGAPSAQQ
LQSQSKIMNVVPQSQINKCNNEKRRRELENEYIEQLGEFLQIKRDMTSCKPDKAAILSEV
VRTFRHMLEQGNPNLTGSRCSKCSPDCSASCKLHPVQQGEVSSTEPPLPEPSVNGHSPEK
SAYFEAVQHYISNVGWALLEINSEGVIECATENVRDVLHYSRTELHGQSIYSYLHTGDHS
KLSPILNKNSFELNWDQNEVSWLLVLDTSSAMMVQSANHGSSFGFPQMFYQTPKRTIRTK
IRWLLRAPEGANETIEQKQQRLEKYKDLLIISAPVKDDTEESSSVLCLITLPEDDQATIE
TTSTMPQTLDEQLTLKLDTNGNIIKYDATTLRKQFAGNLTKETIRSIYDICHYQDRPRLS
DHLGNVRTANGTPLELTYRMRLGGPDVYVHVRAQSKLFCCSKPNESDFIMAICTVLTESE
VALLSDGGGAGGPSFVMGGGTGSTGNPTSSSSLGLLMASTSSNTGTGGLNNGGNDVVSRH
LAQITQGVSTMGGPLMSGVLNGGSGGGTVGSGLGNSSGNMLGGTGSMAGTGTGSSSIGGP
GMGGADLGSVGAQGTGGGGGLGSTIGSIVSPRSNPNTSTTPSMLCPPSSDSSSFFNTDFD
IEFPHSTFDMEAVGVGWDSRPDSRTSVTPVSTPRPPSVSAYSPAAAPMCPSPMTPYYSGN
TMGGMPSPSSNIGTNGGGATPGGGVGGGLVNPNMTLNNNNSNTNNNNNNTGSPFGGNVFQ
FPFEDSKDKLQDLQHQQQQQQHTISNSTWLQSQQQMVQRQHQQQHLQQQQQQQQHHQQPQ
PPSSNSHDSERLRNLLTTKRPHSNASSSSGLDLDHDHRNPNRILKGLLNSEEDKDNNGNK
LSTASLSQRIPQSVRAQAQGNGGSVGGVGGTNGGPGVTVRPANESSKSASNNMLLQLLND
KSDDDDCDTRNRQGPSELLKQLQKVKDEPKDHNPPQLNHEELIQMLRVQSNDRKRPSAEP
DEGSAVKRSDNRPLRERNKMLASLLANPSKAPMQMPNMQNMPLNRIIPDIPSSGLARQLA
NVSSSTAPNQTLNNNNLTTSNNNLKHVQLNQMRMQQQQQQQQMRKVAMPSQSQQQQPPTS
SDIYLNHQQQQLHHHHPQQQQQQQQQQTALLQQQQMLAAQRQQNFSPAIQDSGIGSAGSG
GSYAASTPATSTQLASEWDPELNEILNHVIEIAPEGDFPESELNSLRPIESSSASTVVPS
PSSQPDIHEKLAINAIQKSLMQYENVSSPMQPQQQQQQQQQQQHAAAASGSVQWKPTGLP
NACHGRFWWC
Download sequence
Identical sequences ADAR009528-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]