SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ADAR010911-PA from Anopheles darlingi 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ADAR010911-PA
Domain Number 1 Region: 611-711
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.91e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 217-302
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.09e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 302-356,410-433
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.86e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.1
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ADAR010911-PA
Sequence length 928
Comment pep:novel supercontig:AdarC1:ADMH01003661:34799:40096:-1 gene:ADAR010911 transcript:ADAR010911-RA description:""
Sequence
MVARNFTLQDMPYNRALQVQPDEEREFLTLDELKPHQLTELGVTVSSVAMPSVNSHHPTA
QPQHRVSGPNAADTAPNHPAITTAGGSTAAVPGDHMTGPDASLLVDPSLAGTTMSAVTNL
SSLSAAAAAAAAAAAAAATGSGNHHHHHHLHADNPTGHQHHNNSHHHQTTGSGGGGGGGG
GVGSRKRKFSFNSHFSDTSDVEDDTCDDSKSVRTADESKKQNHSEIEKRRRDKMNTYITE
LSAMIPMCHAMSRKLDKLTVLRMAVQHLKTIRGAVHSYTEGHYKPAFLSDQELKMLILQA
AEGFLFVVGCDRGRILYVSESVSHVLNYSQGDLLGQSWFDILHPKDVAKVKEQLSSSDLS
PRERLIDAKSKSGFTLWDECEWPLLLISFWCSFALAMLPVKTDVPQGVTRLCPGARRSFF
CRMKCKANVQIKEEADATSSTTNSATVCHRRKKQVNSGEYVSWCSDIGFGKSNSMHYPLA
DKKYSVIQCTGYLKSWAPAKIGLEENETDGEGDSCNLSCLVAVGRIQPNLHQPPQHGTAM
QRPSDAGTGNGSNGGGPPTNGGGGGGPNSNGGNTGSAAAAGGGGGGAGGSNGTAGKSAVS
RNSIPNLRNVQFISRHAMDGKFLFVDQRATLVLGFLPQELLGTSMYEYYHHEDIPALAES
HKAALQGTQCVTTSVYRLRTKESGFVRLQSEWKSFRNPWTKDIEYLIAKNNVILSELLLG
GDVNANRNGSGYGVGSDGLGDGTGDGTGVSGSTGQPNVGYEFFNHSNGREIQRMINSHVE
ASKIGRQIAEQVLDHQRRLGDSSSESSPNPNEAAMQPAFSSALSETNHSNDASTSGEHSM
ATSSGVSPSSVSVVPSSVVTTRINGTLPGYSHVQTNAIISPEHDVSQAQANSTDGNDEAA
MAVIMSLLEADAGLGGPVDFSGLPWPLP
Download sequence
Identical sequences ADAR010911-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]