SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156085278|ref|XP_001610121.1| from Babesia bovis T2Bo

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156085278|ref|XP_001610121.1|
Domain Number 1 Region: 559-641
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000196
Family Anti-sigma factor antagonist SpoIIaa 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156085278|ref|XP_001610121.1|
Sequence length 721
Comment sulfate transporter [Babesia bovis T2Bo]
Sequence
MERLSSHGGSVASSAPISSQRSDYQDNRVKVIQYEDEDKDVCVRYYDTDNKDEESTGYNY
HDFSHHTWYDYTRRREPLPAPIEKRECDDIFVCLPFYYGFGRSLLKCSSGVISGWGFNRP
RENFSYYLTEVINGLLCGMTMLPEIISFSFLAGIPPHVALHGTWIACICAAVFGGSPGIM
TGLSGALAAVVGQYAISEQVLNNNILEQHLWSMLVAMFFAGVVLIGCSFFHLASISQFLS
TSVIIGYSNGLAIVIARAQLHGFQDPKTHAYIRGGTLCVAIVYCLIAFSCMQFAHKIPKI
GKYLPSALLAVIIVVFIDIAIVKQVAPELKVTTVGDIACLTTDTALPTFFFLNWDKITNV
TFNRAFFTKVFVLSGTIIMEALMVNDIIKTLSGSDPNSNQQLFGLGIGNVLSPFLGSSGG
SSMVGISIMNLKGGSKGKESSIAAALFIFVMLGGGFPLLNYIPIPSLCGIMFCVSTHCFK
WFSLPMCIVTFMPQAIRNMHPRLKMKITRSDAIIIVAVTILCNLVVIPLAIMAGVILAAF
AYVWESKSRFKVEIYMDNETNIKYYEIEGNIFYASKRMLTRVFTPADDPPTTVIVLLAST
TLFDYTAIETLNSLKVEYAAYNKTLLIKGLSHGCIKKVAKMNHLCRHMEHDLVGIETPNL
PTLYSRFTRLRAKLQLITIRPADDQGEMPVANEKPNEDTDETVQLKIVPHDSKETSTKDT
L
Download sequence
Identical sequences A7AUE2
gi|154797373|gb|EDO06553.1| gi|156085278|ref|XP_001610121.1| XP_001610121.1.62033 gi|156085278|ref|XP_001610121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]