SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000028 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000028
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000000919
Family DNA polymerase I 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000028   Gene: ENSORLG00000000022   Transcript: ENSORLT00000000028
Sequence length 329
Comment pep:novel chromosome:MEDAKA1:1:306663:308712:1 gene:ENSORLG00000000022 transcript:ENSORLT00000000028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRVTFFDFSSAFNTIQPWLLGKKLQQMGVDGGLVSWIIDYLSDRPQFVWLGGVLSDVVTS
SVGAPQGTVLPPFLFTLYTSYFRYNSESFHIQKFSDDSAVICCINGVREEEYRDLVDKFV
RWARANHLLLNVEKTREMTMDFRKKPPASQPLSIFGRDVAEVEEHMYLEVTIDNRLSWKS
NSTAVYKKASSRLHFLRRLRSFYQSVVASTLFFSVVCWGGSISARDSNRLNKLIRRAGSV
LRQLRCHTNRFRRSFIPHSIGLYNFSSMCNSQQRDSQTQRRFLEDLDIKIQTINQRETSV
LLELLEHLRTSIRVQTHMHKLEFRLPLLF
Download sequence
Identical sequences H2L2T2
ENSORLP00000000028 8090.ENSORLP00000000028 ENSORLP00000000028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]