SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000738 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000738
Domain Number 1 Region: 792-1208
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.89e-88
Family Reverse transcriptase 0.0013
Further Details:      
 
Domain Number 2 Region: 479-630
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.96e-39
Family Retroviral integrase, catalytic domain 0.0044
Further Details:      
 
Domain Number 3 Region: 82-164
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.11e-24
Family SCAN domain 0.00062
Further Details:      
 
Domain Number 4 Region: 242-331
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000027
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000738   Gene: ENSORLG00000000598   Transcript: ENSORLT00000000738
Sequence length 1221
Comment pep:novel chromosome:MEDAKA1:4:1680644:1700372:1 gene:ENSORLG00000000598 transcript:ENSORLT00000000738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPKPRPRFCTQPKISPYQEGEDIENYLLRFERMAKTWKWPETEWACRLIPFLSGKALDAY
TAMDEDKADSYKDLKEALLTKFDISPETYRQKFRCASVPRGETPLETYNRLKGLYRRWIQ
QERRTKEQVGESIILEQLPYVLPPEVRTWVKEHEPGDGSEAAYLNARRGGPSTRSTMATR
PINVAQPTTDVRPPVFPTPQLGTEREASVRHRPVCRLKKTKVTGACFVPRNEVEPSANDN
VRKRTYKTMTVNGVSVLALIDSGSFTSLISKRLVPIGSLDYGHLTNVVCVHGDNHAYPQT
EITVYINEQLYLLTVGVVDNLPVDLLLGRDIPVLVQLLQGERSGDANQVHPQNSVSCPVI
TRAQAKTGVLPLPDLDESLCEGGSKLPKRDDILKQLFKKVKNIDEVTSMGMDCFIIENGM
LYILNDNHKDLGHHKTYMCVSSRFYWPGMYTDIQSYYMTCPICQKTAAPRRLDRACLQPL
PIISTPFQRIAMDIVGPLEKSSQGHQYILVVCDYAIQYPEAFPLRTITSSAIIHALTELF
SRVRIPDEILTDHGTNFCSRLMQQLGIKSLRTTPYHPETDGLVERFNQTLKRMLQKFVSE
TGKDWHRWLPFLLFAYREVPQASTGFSPFELLYGRNVQGPLDLLSKAWEGSASNQKEIGV
VQFILEMRERLAKYQAEAEMNLKKAQRAQKTWYDQQARHRDFRPGQKVILLPSSTSKLLS
KWQGPYTITQKMGPVIYKIHHPDKRKQYQTYHVNLLKELKEPHQSLPEPVGLVVKGAHLT
KTKETQIQQVLQAVQSLFRGKLGRTNLANHVIRLKYNRPIRQRPYRVLQQFVGRLDNSVN
QQLKTLQVISKSMRAIASPILSFDVQMYSFILHVCPFYNKLPEIIKFDALPFPRSPTAFD
QLSGAQVFTKLNLRSAYHLVHIWEGDEWKKAFNPPSGHFKYLVMPFGLTNAPAIFQCLVD
DVLKDMINKFVFVYLDHFLIFSQDDLDTHVQHVRAVLQPLLENELYCKAEKSEFHTSQTR
FLGHVVTPGSVQMDNTKVKAVLEWLVPSGRKQLQHFLASVVLLHPSISLLQLSWDKADKV
FTELKRRFSTTPILTQHDHTKQFIVEVDAESEVGAVLSQMVSDNKVHPAYFFCNLTPAER
NYDIGNRKLLAVRLALEEWRHWLEGAEQPFLVWTDHKNLEYMPTAKRLSPCQASWSLFFD
RLNFTLSYQPGSKNVKPDVLS
Download sequence
Identical sequences H2L4P2
ENSORLP00000000738 8090.ENSORLP00000000738 ENSORLP00000000738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]