SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001482 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000001482
Domain Number - Region: 19-147
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000645
Family DNA polymerase I 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001482   Gene: ENSORLG00000001203   Transcript: ENSORLT00000001483
Sequence length 190
Comment pep:novel chromosome:MEDAKA1:11:2770945:2772224:1 gene:ENSORLG00000001203 transcript:ENSORLT00000001483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TYSHLDEGAGAVRMLFFYFSCAFNTIHPHLLQEKLTRMTVQPFLVSWIMDYLTNRQQYVH
MGGSVSSTLSCSVGAPQGTVLSPLPFTLYTSDFRYNTSTCHMQKFSDNTAIVAYMKGEEE
REYRRLVEDFVAWCGENELQLNIQKTKEMVLDFRRKAQTPQPVHIEGEICVCVLGVLADA
MLMCLKVLAL
Download sequence
Identical sequences H2L6N2
ENSORLP00000001482 ENSORLP00000001482 8090.ENSORLP00000001482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]