SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002242 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000002242
Domain Number - Region: 139-397
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00267
Family RNA-dependent RNA-polymerase 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002242   Gene: ENSORLG00000001802   Transcript: ENSORLT00000002243
Sequence length 886
Comment pep:novel chromosome:MEDAKA1:2:18380519:18385823:-1 gene:ENSORLG00000001802 transcript:ENSORLT00000002243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIKQRRSLRKAWSKAADDEKEGLKALWVQVRDRLAALRRAERIRRRSRKEKESAKFFQDP
LKFAKSLLEEKKSGRLNATVQELEEHIKSQLSDPDRNTPLGLPGYVPRPAEPKLQFDTMP
PRWAEIRQGPNGVPYKVYKNCPAVLKLLWKLVRVAWKTQAIPTWSKAISTFIPKEQDSRS
INQFRGIALLNVEGKIFFSVVVKRMANYFLENNYIDTSCQKAGIAGFSGCVEHSTMIWNQ
IQADKREKSDLHVVWLDLENTYGSVPHQLITFALEFFYISICIQRLTCNYFSGFQVCYTT
YEATTSWHLKKGIAMGCSISPIIFTAAFEVILIGGRQMGLGKKSQSGQRLPALRSYMDDV
TSLLQTAPCTTRFLKRFEDLLGWARMRIKPSKSRSLSIRKGVRNYHISFTVNGERIPLSA
EQPVRSLGRLYTAELEQSPSCQLKDGLERIDKSHLPGKFKVWCYQFILNPRLMWPLKLCE
ITSSTVAKMDAKANNFIRKWLGLPQSLSNTGLFGRLPLKPISLGYRQEKTRLVLELRDST
NPVIRNTKAPVRTGSKWKAEEAVDQAISKLKHNKIVGKTQSGRAGLGWRIAPKFWSKATR
SEKKELVIEEVTRSEENQYKIKALSQPQQGRWTTWDQRTIVWSDIWKMPQARLSFLIRAT
YDTLPSPSNLSLWFGSEENCHLCKTPSPTLQHILSGCKAALAQGRYRWRHDQVLRKLAEV
LEVRRMEAAKDPPTKTPSLIHFVGEGAGAQNTNQRGTPSLLTPGCDWNLRVDLDRQLNVC
ESIITWHLIILWSSAAKAVILAELTIPWEGGMDAAYEKKKDKYTELVAECRDAGWSTIIC
PVEVGCRGFVGTCTQLLLSKMGVTGSKLKKASKDLAEEAEKASFWL
Download sequence
Identical sequences H2L8R2
ENSORLP00000002242 8090.ENSORLP00000002242 ENSORLP00000002242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]