SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002630 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002630
Domain Number 1 Region: 15-390
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.89e-33
Family Reverse transcriptase 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002630   Gene: ENSORLG00000002113   Transcript: ENSORLT00000002631
Sequence length 459
Comment pep:novel chromosome:MEDAKA1:6:5685736:5688704:1 gene:ENSORLG00000002113 transcript:ENSORLT00000002631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVLFKPRAPFPVFRVSPLGVATRKYSGKKRLIIDLSAPHSSSIPSVNSLIPREPFSLFYV
SVDNAICMIKSAGQGAWLGKADISDAFKIMPLHPSQWHVFGVRWRSKYYFSVRLPFGCRS
SPRIFDSLSEALCWILYNSFRLPYVLHLLDDFLVIDFPSSPPHRCISAVTALFSHLGVPL
SPEKTCGPSTRLEFLGIILDSSLMQASLPSDKLTRIREAVSSFLSIGRVIKRDLLSLLGH
LNFAMRIIPHGRSFISRLLDVANSVPGLHDPVVLDDGSRSDLRFWSLLLTAWNGVSFFYN
DRFESSNSLHFFTDAAPSVGFGGIFYDEWFADVWPAEILEAVPPSSAALFELYPIVVACS
LWGKKWSKKRIMVFSDNAAAVEIINKGRSKCVLINSLMRRLTWFSVMNNFILRATFIPGH
VNMVADALSRFKFQEFKILCPTANPHSLLCPTFQQMILD
Download sequence
Identical sequences H2L9T3
8090.ENSORLP00000002630 ENSORLP00000002630 ENSORLP00000002630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]