SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000005424 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000005424
Domain Number 1 Region: 339-1177
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.07e-260
Family T7 RNA polymerase 0.000000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000005424   Gene: ENSORLG00000004329   Transcript: ENSORLT00000005425
Sequence length 1177
Comment pep:novel chromosome:MEDAKA1:4:7751493:7782334:-1 gene:ENSORLG00000004329 transcript:ENSORLT00000005425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVLEARIQQLQTDVASDVQHAKVHFVKVPPFGRAFSSGGTHKGSPQEKPDIPKPGQTSS
KGTKKSEFSRWKEKLSQEKKNKLKKQQHLQQKMQTSVKDKQSAKSKASTMATGTTHKTIS
SKAKQSRERLKLSEEIQAAVSSTTASIKASKKKQKDPKNTVPDRDGIRSYLEACIFIGDV
ERAQRFLLSQHRVRSRRKLLNTGVYNIMMRVWAKKGMLNQIGRIFILLEEAGLKPNLGSY
SAALECMGRNPNCSPKAISRCLNQMEEDGLTLDDLFSDCVFRRDEKDMMLQAIRAVEPGY
EPRPHLLTDECPSPLVHHFYTQREHHSYPKLALSQEELLERFQQQLSVERACTVTIDSVE
TTKPVTENMRKMRELLAEQRTHWEKILHQALRESKMILANTNTRDYRLNLYPYLCLLEDG
EYVDIMIQSVANMPPSGESLKVLARDLGHRVYTKYCVRQKFENQAVEKLGSIYSAYTELL
AKDTKVSRVLPREQWTRLQMEQSSGPSLQGDDTSWPHIVTLELGTHLVDIMVKNLKINSD
ILNPSQDRKLIPILYHMYTFRSTRQVGFIKPHPILVQMQQEAMETRLTFDSYVMPMLCPP
VPWTSVKFGAYVLTPTKLMRTVEGATQHEQLLEKSQHLEPVFDSLNQLGNCAWKINKPLL
DIIISIFNDRGSDKLDIPPPMSEAPKIPHFNPQDPAYTASQKALMKREVINAKKKGSEMH
SLRMDALYKLSIAHHMREETFWFPHNMDFRGRTYPCPPYFNHLGSDVTRAMLVFAEGKPL
GPKGLDWLKIHLVNLTGLKKRSSLQGRLQYANSIMEDILDSADNPLHGRKWWMNADEPWQ
ALACCMEIARAARSPDPAKFVSHFPVHQDGSCNGLQHYAALGRDVIGATSVNLVPCDVPQ
DVYSGVAQQVEELRARDARDGLKIAQVLEGFISRKVVKQTVMTVVYGVTRYGGRLQIEKR
LKEIENFPKEHIWDASHYLVRLVFNGLKEMFTGTREIQDWLTESARLISKCGHTVEWVTP
LGLPIIQPYHRTRNQVQLKSSIQHINLQISHDSKERPDTVKQKNAFPPNFIHSLDSTHMM
LTALHCYSAGLTFVSVHDCFWTHALTVDTMNKVCREQFVALHSQPILQELSDFLLHKYCS
GSGLPLERSRSKALTPSPPSPGDFDLQQVKESTYFFS
Download sequence
Identical sequences H2LHG2
ENSORLP00000005424 8090.ENSORLP00000005424 ENSORLP00000005424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]