SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006252 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006252
Domain Number 1 Region: 181-532
Classification Level Classification E-value
Superfamily AF1104-like 3.01e-98
Family AF1104-like 0.00000105
Further Details:      
 
Domain Number 2 Region: 2-131
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.2e-39
Family Fumble-like 0.0000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006252   Gene: ENSORLG00000004961   Transcript: ENSORLT00000006253
Sequence length 536
Comment pep:novel chromosome:MEDAKA1:15:16637658:16645583:1 gene:ENSORLG00000004961 transcript:ENSORLT00000006253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVESEDKFERIGGSSIGGGTFWGLGALLTKTKRFDELLQLASKGQHTNVDMLVKDIYGGS
YGCLGLTGDLIASSFGKSATADKDFCKEDMAKSLLHMISNDIGQLVFQGEVQALFLRHEG
YLGAIGAFLKGAEEDNPNQYSWGENYAGSSGLMSVSPEMNPLQRARSGTFDMLEMDRLER
QLVNLPLLQDPSSYIPDTMDLTEDAPAREYWLYCFEEALDGVVKRAVASQPDPQEAAARA
EKFCQKYRHKLQTLRHQPFAYGSLTVRSLLDTREHCLNEFNFPDPYSKIKQRENDSALKY
FQKAVKALEQLSWEDRQFALVRGVLAGNVFDWGAKAVSDVLESDPEFGFEEAKRQLEVRP
WLVDCFDRWLERLKGPPHKCALFFVDNSGVDIILGVMPFVRELLSRGTEVVLASNSGPAL
NDVTNGELQILTERIAAMDPVIRSGLKEDRLTLVQSGSSSPCLDLSRLDKVLAMVVRERQ
TDLVIIEGMGRAIHTNYHAMLSCESLKMAVLKNSWLADRLGGKLFSVVFKYEVPAG
Download sequence
Identical sequences H2LJR0
8090.ENSORLP00000006252 ENSORLP00000006252 ENSORLP00000006252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]