SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000006617 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000006617
Domain Number 1 Region: 1808-1997,2044-2227,2255-2309
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.67e-111
Family DNA polymerase I 0.000000647
Further Details:      
 
Domain Number 2 Region: 40-203,236-291,341-428
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.31e-42
Family Tandem AAA-ATPase domain 0.00023
Further Details:      
 
Domain Number 3 Region: 587-758
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 5.75e-42
Family Achaeal helicase C-terminal domain 0.0015
Further Details:      
 
Domain Number 4 Region: 1649-1803
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000455
Family DnaQ-like 3'-5' exonuclease 0.013
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000006617
Domain Number - Region: 461-545
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000463
Family SCF ubiquitin ligase complex WHB domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000006617   Gene: ENSORLG00000005243   Transcript: ENSORLT00000006618
Sequence length 2314
Comment pep:novel chromosome:MEDAKA1:1:16500336:16514042:-1 gene:ENSORLG00000005243 transcript:ENSORLT00000006618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHAEKLLLSSWGLPKPVLERYQKHGVTQMFEWQQCLTVGQVLQGGNLVYSAPTSAGKTLV
SELLMLKRVLETKRKALFILPFVSVAKEKMQYLQSVFQEAGVRVEGYMGSTSAAGGFTTL
DVAVCTIEKANSLVNRLIEEDNMALLGMVVVDELHMVGDSGRGYLLELLLTKILYISQKQ
KTFQRSLSEGVQIIGMSATLPNLALLAGWLGAELYQTDYRPVPLEEHLKVGCSIYDRSLS
VVRQFTPVLHVKGDDDHIVSLCYETVRQGHSVLLFCPSKNWCEKLADTIAREFYNIRLSV
KTLNGKAEPLPVCLDHDGLMDVLAQLRRTPAGLDPILQRTVRWGVAFHHAGLTFDERDVL
EGAFRQGLVRVLSATSTLSSGVNLPARRVIIRTPTFNGHLLDPLTYKQMAGRAGRKGVDT
RGESLLVCKKAEEKKGASLLRGSLQPISSCLVRREGEGVATSMLRAILEIIVGGVACTPQ
DVQRYASCSLLAASVRCDSKKPSGKESNRGAIEACVEWLMENEFINIQKDEQDERYCPTQ
LGAATLASSLSPPEALGIFADLQRAMKGFVLENDLHIMYLITPLYAEWTTIDWYQFFCLW
EQLSSSMKRVAELVGVQESFLARSVSGKLVAKTEKQSRQMAIHKRFFTTLVLQDLVNEVP
LGTVASKYNCNRGQLQSLQQSASTYAGMVTVFCKRLGWHNMEMLLSQYQTRLSFGVQREL
LDLVRVSLLNATRARALYAQGLCTVAELARATVADVEKALRNSVPFKSSKRAVDESEVEA
AERRSLRCVWVAGGRALTEQEAAVEIVSEARLLLREDLAQLGVQWDPAALPAEASVACSP
DGHSSRDSDTSNQLKEDREGGKRMVVGEDGKNEDPNGLYVRKKAHTERKEEKMRAHTNKP
IQNYTENPDRAVERKHNGEHEKADQGETGRATSKPDDLQSKQPVPEKSLTQELAEIISSL
SPQLLPPPPPSPSPAPPPRFRAPISRLESQQRGDRSIAVEEGLTKLTTSPLELERLRHSK
ALSKVLQSIQCIQDSVDPGEKGDSKTTVISNLQNSKSPVEVLNAAQTFSCAQERAPGSTT
AHISNSVLSVSPGSVDRCSPEAKRRKIDTKEAEKFSSPELYAGDDRDEEVDVQASFGDSF
ELDTQTERIIVQQTHQHSDESSAGTDQSEAQHIREEEAAGKHLQTSDEKRNDSPDSATPK
FNISLTESQMELILNTSHQVSDCLLNVRLMLVPQKSPSPAAGDNIDKREDPGAAPESPNR
SSSLLFDSLYDSPLLEALRPEPSDEEPNTEAEHPSTTQQRRRSELLANQEAEEQEGVRWG
ESFFNLSEWGDSLLVGEHFLERQNLLRFSEQSEKEQMVQQAIKDQEDQSGNLIQFVNEEQ
GEEQNIISRGDDRGRQSDENPGLQDIFDRWPSMSDQPGLSASEMQGNSANAAIQPQTDAA
KTEPQIGRLSGCGDENPMHRPGSAGDLIPPTQSTPSNPSQVTSGNGNLLSAVASASKRQE
NISPKKELKSIPHQSSKPNAKQTDQNIPLPTQCTSPSSPGPRSPSDAESPVIPEGFSLQL
SQDETLGCSNPGTFSIIDVASDRRLFETFVTEWKTKERFALALACEKKEHSQQQEGEIGG
KHRRASSVTNLKPNGPDGFPVRNNEGLVLIGLSVCWGARDAYYISLQEEQSKGLSSSLAP
PPLDDDLVVTERLKQVKECLGGQSVDNKVHEVVAYDIIQVYKTLVLSCGISLEGNCEDPK
VACWLLDPGSEERTISNMVTVYCPEELALLEGLGNPHSYCPRVRAATSSVLLHTVMNHLT
GLLEKDGTLDLFRNVEMPSQVCLALLELNGLGFSVEECERQKHVMQAKLSALESEAYTLA
GHSFSLTSVDDIAQVLFLELHLPPNGEIGGIRTKKTLGYTRRGGGRVRFGKQFSTTKDVL
EKLRPLHPLPGVILEWRRITNALTKVVFPLQREKQYHPTLKMDRIYPIAQTHTATGRVSF
TEPNIQNVPKDFDIKMPTMVDESPPSQNAPHRPGIISQRKKRRPLTPALTRGLAEQGPAF
SVSMRHAFVPFSGGMILAADYSQLELRVLAHLSKDQRLLQVLNGGADVFRCIAAEWKNVD
PESVQDNLRQQAKQICYGIIYGMGAKSLGEQMGVEENDAACYIESFKARYKGINAFLKQT
VKNCIKDGFVQTLMGRRRYLPGILSSSPHIRAHAERQAVNTTVQGSAADIVKLATVNIQK
RLQKTYPAAPPSHQHLHTGDQTTVSPRNQRRAVRGAYFILQLHDELIYETTQEDLIQVAQ
IVKREMESAVKLYVKLKVKVKMGCSWGDLQDLDI
Download sequence
Identical sequences H2LKR3
8090.ENSORLP00000006617 ENSORLP00000006617 ENSORLP00000006617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]