SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007858 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007858
Domain Number 1 Region: 10-141
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000133
Family Reverse transcriptase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007858   Gene: ENSORLG00000006253   Transcript: ENSORLT00000007859
Sequence length 147
Comment pep:novel chromosome:MEDAKA1:17:8854118:8866801:1 gene:ENSORLG00000006253 transcript:ENSORLT00000007859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TISNLEHQGNYARLLFIDFSSAFNTILPDRLTTAGHCCWIRNFLSDCVQRVRGSPHLSTA
LTINIGSPQGCLLSPLLVANQVNKCVASHKDNIILKFADDTAVIGRITGGDEAAYRREVA
SLVTWCEDNNLTLNTDKTKEMIVDMRK
Download sequence
Identical sequences H2LP78
8090.ENSORLP00000007858 ENSORLP00000007858 ENSORLP00000007858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]