SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008122 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008122
Domain Number 1 Region: 62-186
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000682
Family DNA polymerase I 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008122   Gene: ENSORLG00000006470   Transcript: ENSORLT00000008123
Sequence length 267
Comment pep:novel chromosome:MEDAKA1:1:19748130:19749978:1 gene:ENSORLG00000006470 transcript:ENSORLT00000008123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILLHLDSPGTYARILFVDFSLAFNTILPSSSPAKRAGLHLQWITDFLMDQRQCMPLGKNF
STTQFISTGSPQGRVLSPLLFSLSTNCCTSCHDSLKLIKFTDDTTFIGLISNNDESAYRR
EVDRLVSWCSINNLELNTQKTVEMIVDFRKVTAPSSPLILTDSPITIADSVPLLGTTITQ
DLKWEPSISSLLKKAQQRMYFLGQLKRAKLPAQMMVQFYTTIIHPPPSHSGHGLLEPLPS
GRRLRSIRTRTSRHKNSFFPSAVRLMN
Download sequence
Identical sequences H2LPY6
ENSORLP00000008122 8090.ENSORLP00000008122 ENSORLP00000008122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]