SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008189 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008189
Domain Number 1 Region: 5-312
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.87e-79
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000133
Further Details:      
 
Domain Number 2 Region: 318-435
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 7.85e-23
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008189   Gene: ENSORLG00000006526   Transcript: ENSORLT00000008190
Sequence length 699
Comment pep:novel chromosome:MEDAKA1:15:20054665:20058293:-1 gene:ENSORLG00000006526 transcript:ENSORLT00000008190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYGKERVVALVDMDCFYVQVEQRLNPALRNTPCVVAQYKTWKGGGIIAVSYEARAHGVT
RNMWVDDAKKLCPDLQVARVRESHGKADLTHYRDASVEVIEVMSRFAVIERASIDEAYMD
LTAAVQQRLKTTTEEQMSPCLLKTTYIQGYPQNASPEEMILYKEELRSKGLQQWMESLPT
PSSGELNCAELQLTMGALIVEEMRAAVEKQTGFRCSAGISHNKVLAKLACGLNKPNRQTV
LPLESVTELFNSLPIGKIRNLGGKMGASIIETLKVENMGDLTRFSQSQLVQHFGEKTGQW
LYDLCRGVESEAVKPRQLPKSIGCSKNFPGKTSLATKEQVQYWLHQLALELEERLNKDKE
TNGRVAKLLTVGVRQLGDKRPSSFSRCCALVHYEAAKLSSDSFAIIKSLNTAGNHQAAWT
PPLTLLHLSASKFSDAPSSGGIAGFLSAGVAPGRSVSATSKVSTPQASELKQDSACKQRG
SIQAFFQKAPVKQKGVRMDVEEEIPPLSGTSPTCTDDSQLQTAACSSESLPQSKLSSGFC
SFFHKKTLEKSKHEPQNNPGSSENNESKAAETAGAEPQSKRSSELTPHHQPHAEDSDPES
NCNRTSVAAEDLLKCDRCGQEVLVWEMPEHNDYHFALDLQNSISSSTGSSSSSGSPAPLR
GSVQHPQGKTKTRGQFGPAAKRPRSQGGSKGTLDSFFTK
Download sequence
Identical sequences H2LQ51
ENSORLP00000008189 8090.ENSORLP00000008189 ENSORLP00000008189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]