SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009391 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009391
Domain Number 1 Region: 809-1248
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.61e-121
Family DNA polymerase I 0.00000229
Further Details:      
 
Domain Number 2 Region: 437-807
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.74e-75
Family DnaQ-like 3'-5' exonuclease 0.0027
Further Details:      
 
Domain Number 3 Region: 1353-1390
Classification Level Classification E-value
Superfamily Zinc finger domain of DNA polymerase-alpha 0.00000000000000301
Family Zinc finger domain of DNA polymerase-alpha 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009391   Gene: ENSORLG00000007489   Transcript: ENSORLT00000009392
Sequence length 1472
Comment pep:known chromosome:MEDAKA1:20:13318876:13379683:-1 gene:ENSORLG00000007489 transcript:ENSORLT00000009392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPVSNPEKDVDAAGSDDGGDGCSLAKSRSRREKREKVGRKSALEQLKKAKMGEKIKYKV
EEFSHVYEEVDEEQYSKLVQERQEDDWIIDDDGTGYVEDGREIFDDDLDDDVVEKRGKKQ
SEGVAGAESKKTVKKAAVTKPNTIKSLFMNSNVKKPAEKDIDLSKDDLLGDILQDLHSEV
TVLAPPPVITLKKKKSLGSPMNPFSIRHQMPKSPMTGLKAKTVRPPPAELRPPACPSPPL
EKSSEKVEKPKEEEEENDSLALDEVDFDEPMETEPEIKEETEAEAAPSVPKVEPKKEPLS
PAPLFSSCCSPSRVGGHWGQEEETGASDVPAEVHVDSSQLPLVEGEDGEPAFRFYWLDAF
EDPYNQPGVVYLFGKVWIQSAKSHVSCCVTVKNIERTIYLLPREYKTNPKTGEVSGEPVG
MMDVYQEFSELSEKFKVMKFKSKVVEKNYAFEIPDVPNQCEYLQIQYSAEFPALPPDLKG
ATFSHIFGTNTSSLEHFLLSRKIKGPCWLDIKTPQMMHQPVSWCKVEVLALRGDTISLVK
DLPPPPLTVMSISLKTVQNPKTHHNEIVSLAALLHYGFHMDKAPPQTPYQNYFCVISKPA
DCIFPYDFKEALRKKNGKVEIASTERTLLGFFLAKMHKIDPDVLVGHDIFGFDLEVLLQR
INVCKVPHWSKIGRLRRANMPKLGGRGLFAEKNATCGRLVCDVEISAKELIRCKSYHLTE
LAAQVLKVERVTVPQEEVKNLYSDSPHLLYLLELTWTDAKLILQIMCELNVLPLALQITN
IAGNVLSRTLMGGRSERNEYLLLHAFHDKNYIVPDKPSFKKAQLEMGDGEEDVDAGKGKR
KKKAAYSGGLVLDPKVGFYDQFVLLLDFNSLYPSIIQEFNICFTTVQREAQNSRRKREED
ESEEIPEIPDPGLEMGILPKEIRKLVERRKQVKQLMKQQDINPDLYMQYDIRQKALKLTA
NSMYGCLGFSFSRFYAKPLAALVTHKGREILMHTKDMVQKMNLEVIYGDTDSIMINTNSK
SLEEVFKLGNKVKAEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVEHHGDGRYSVKQE
LKGLDIVRRDWCDLAKECGNYVIGQILSDQSRDIIVENIQKHLVEVGERVANGDIPLNLY
EIHKALTKDPQDYPDKKSLPHVHVALWINSQGGRRVKAGDTISYLICKDGSTLAASQRAY
ALEQLQKQEGLSVDTQYYLAQQIHPVVSRICEPIEGIDGVLIATWLGLDPSHFRSHQQHQ
REEEADGMLGAPVQLTDEERYRDCERFTFTCPSCGTDNIYDNVFEGAGNKVEPGLMRCCH
IPCQSRPIDHPVHISNKLLLDIRRHIKKYYSGWLVCEDQACQNRTRRLPIAFSRHGPICP
ACSRATLRPEYSEKALYNQLCFYRFIFDWEHAFSKVLTQEERRKPKFSYTKLKPLLSFVY
RKLKEVPEKALAASGYSEVNLAKLFQAFSSLK
Download sequence
Identical sequences H2LTH2
ENSORLP00000009391 ENSORLP00000009391 8090.ENSORLP00000009391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]