SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009820 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009820
Domain Number 1 Region: 514-547,615-667,697-1163
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.9e-89
Family DNA polymerase I 0.00034
Further Details:      
 
Domain Number 2 Region: 60-175,221-518
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.15e-81
Family DnaQ-like 3'-5' exonuclease 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009820   Gene: ENSORLG00000007834   Transcript: ENSORLT00000009821
Sequence length 2277
Comment pep:novel chromosome:MEDAKA1:9:12950809:12964522:1 gene:ENSORLG00000007834 transcript:ENSORLT00000009821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLQNSGRYRTDRGPNGGDQENQDDGSSMSALKRLERSQFTDDMDARFGFDRMKEPGEKT
GWLINMHPTEILDEDKRMISAVDYYFIQEDGSRFKVALPFKPYFYIATKKNCEREVISYL
SKKFQGKVAKLEMLPKEDLDLPNHLVGLKRNYIKLSFNTVDDLIKVKREIAPAVRKNRER
EQSHDEYTSMLSSALSGVGVTTADEDGMSKSIVDQLDNVVDMREYDVPYHVRLSIDLKIH
VAHWYNVRYRSNAYPLEIIRRDDLVERPDPVVLAFDIETTKLPLKFPDAESDQIMMISYM
IDGQGFLITNREIVSENIEDFEFTPKPEYEGPFTVFNEDNEAALIQRWFDHVQETKPNIF
VTYNGDFFDWPFVETRAAVHGLNMHREIGFQKDSQGEYKSSQAIHMDCLRWVKRDSYLPV
GSHNLKAAAKAKLGYDPVELDPEEMCRMATEEPQTLATYSVSDAVATYYLYMKYVHPFIF
ALCTIIPMEPDEVLRKGSGTLCEALLMVQAFHANIVFPNKQEQAFNKLTDDGHVLDSETY
VGGHVEALESGVFRSDIPCRFKMNPAAFDFLLQRVERTMRHAIEEEEKIPLEQVTNFNEV
CDEIKEKLTSLKEVPNRIECPLIYHLDVGAMYPNIILTNRLQPSAMVDEATCAACDFNKP
GATCQRRMAWQWRGEIMPASRSEFHRIQQQLESEKLPPLFPNGPPRAFHTLNREEQAKHE
KKRLADYCKKAYKKTHVTRLEQRVTTICQRENSFYVDTVRAFRDRRYEFKGLHKVWKKKL
SAAQDSGDAAEVKRCKNMEILYESLQLAHKCILNSFYGYVMRKGARWYSMEMAGIVCYTG
ANIITQARELIEQIGRPLELDTDGIWCVLPNTFPENFVVKTSNEKKPKVTISYPGAMLNI
MVKEGFTNDQYHELVDPASLTYNTRAENSIFFEVDGPYLAMILPASKEEGKKLKKRYAVF
NEDGSLAELKGFEIKRRGELQLIKIFQSSVFEAFLKGTTLEEVYTSVAKVADYWLDVLYS
KAANMPDAELFDLISENRSMSRKLEDYGEQKSTSISTAKRLAEFLGDQMVKDAGLSCRYV
ISRKPEGSPVTERAIPLAIFQAESSVKKHFLRKWLKMPSLHDLDIRSILDWSYYIERLGS
AIQKIITIPAALQQVKNPVPRVRHPDWLHKKLLEKNDIYKQKKISELFTSEGKRQVAHKH
LDTDQQADIEDFGVPARPLQPAILISTKRKRASQGVDSQVESQDVELTQSWREILGPPPP
MGTTREERLVWLRYHKKKWELQLKQRKERRKRRKLLDGEAQPVGGGVIRDGPTTGLGSFL
RRTARSILDMPWQIVQIAETAHPGLYKLWAVIGNDLHCMKLNIPRVFYVNQKVNRMLPRS
NMVYYLYEYSVPEDMYQEHINEINADLSAPDIEGVYETQVPLLFRALVRLGCVCMVNKHV
VRDLAGREADSFDLDHLEMRSLAQFSYLEPGSVRHMYLYHHSQGHKALFGLFIPSQRKAS
IFILDTVRSNQMPNLSNLYSAERTALLERTTEELLPPEKHTFEIRAENDMKAISRALQRI
LLSYKEERRGPTLIAVQSNWELRRLTAGMPVLEEFPVIPVHVVDDINYNVLDWQRHGARR
MIRHYLNLDSCLSQAFDMARYYHLPVGNLPQDVSIFGSDLFLARHLRKHNHLLWLSPTAR
PDLGGKEADDSRLVMESDDRGSVEINAPGCFSTVCVELDLQSLAVNTILQSQHVNDMEGG
ASLGVSFDVIQQASLEDMMSGNQGASALASYDETALVSNTFSRILKSMVVGWVREITQYQ
NVYADNQVMHFYRWLRSPSSLLYDPALHRTLHNMMKKVFLQLAAEFKRLGSTVVYGNFNR
IILCTKKRRIDDAVAYVEYITNSIHSREIFHSLSISFSRCWQFLLWMDPSNYGGVKGKVS
SDVLYGEGDTKQKKTRQGEEDEDGSEDEEEDNAEEEDEESDDVENLIESNWNIMHYLPQT
ASCQQYFLMIVSAYIAAVYHSMKEELRRNAPGATPVKRRVGSQASQQALGDLTALPGMIS
FSQEYVASELTQNIFTITQKIQKKVAGTRNVTQTSEMFPVLPGSHLPLNNPALEFVKYVC
QVLSLDTNIVNQVNKLKRDLLRLVDVGEFSDEAQFRDPCNSYILPEVICHHCNFCRDLDL
CKDPSVAQDGAVVPQWFCSNCQAQYETDSVEVSLIEALQKKLMSYTLQDLVCNKCKGVKE
ANMPLYCRCAGDFSLTFSAKSFSEQIMVFRNIASHYNMRFLEETIDWLLAMSPQIEQ
Download sequence
Identical sequences H2LUP2
8090.ENSORLP00000009820 ENSORLP00000009820 ENSORLP00000009820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]