SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010058 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000010058
Domain Number - Region: 19-146
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00623
Family Reverse transcriptase 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010058   Gene: ENSORLG00000008017   Transcript: ENSORLT00000010059
Sequence length 162
Comment pep:novel chromosome:MEDAKA1:18:19400034:19402039:-1 gene:ENSORLG00000008017 transcript:ENSORLT00000010059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CINHISLPFSHHSLLLLYFSCAFNTIQPFLLQQKLLSFGTNFQLVSWITDYLTNRPQFVR
MGSCSSSMLTGSTGDLQGTVLSPLLFTLYTTDFHYNSDACHIQKFSDDAAIVACIKEGEE
GEYRQLVEDFAHWSQRNCLHLNITKTKEMVLDFRRTPDAVQP
Download sequence
Identical sequences H2LVC7
8090.ENSORLP00000010058 ENSORLP00000010058 ENSORLP00000010058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]