SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010728 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010728
Domain Number 1 Region: 21-124
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000111
Family RNA-dependent RNA-polymerase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010728   Gene: ENSORLG00000008543   Transcript: ENSORLT00000010729
Sequence length 127
Comment pep:novel chromosome:MEDAKA1:10:20211069:20211449:1 gene:ENSORLG00000008543 transcript:ENSORLT00000010729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCSSPPPSSACSSSSPDAVTPIRIEEVCIELRRLNGWKSAGPDGISPRLLKDCASELAVP
LQTIFNRSLQTGCVPGLWKTSCLVPVPKVTRPAGMKDYRPVALTSVIMKTFERLLLRRLK
PQVEGAL
Download sequence
Identical sequences H2LX73
ENSORLP00000010728 8090.ENSORLP00000010728 ENSORLP00000010728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]