SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011185 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011185
Domain Number 1 Region: 280-406
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.8e-26
Family Regulator of G-protein signaling, RGS 0.0022
Further Details:      
 
Domain Number 2 Region: 498-633
Classification Level Classification E-value
Superfamily PX domain 5.1e-22
Family PX domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000011185
Domain Number - Region: 238-270
Classification Level Classification E-value
Superfamily ISY1 domain-like 0.0144
Family ISY1 N-terminal domain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011185   Gene: ENSORLG00000008915   Transcript: ENSORLT00000011186
Sequence length 838
Comment pep:novel chromosome:MEDAKA1:10:21227442:21242702:1 gene:ENSORLG00000008915 transcript:ENSORLT00000011186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDKALKEVFDYAYRDYILSWYAPLSRDEGQLYSMLLEDWWQMIGQLRSRLADINLVNVVC
YDSIRILHTHFTDLKAASARPEEVSRPFPLHPCLVSPDLEMAFLRCVARILLLCLLPQKD
AKSHTLRCCLTEVITSKVLKPLVEVLSDPDSINRMLLSQLEQREQQAEQQKKAYTYAASY
EDFIKLISTSTDVDFLKQLRYQIVVEIIHATTISTLPQLKKQKERKGKESAAMKADLLRA
RDMKRYINQLTVAKKQCEKRIRLLGGPNYENNEDGGADDSDEPQSQKILQFDEILCNPGY
REHFRVYMERVDKRALICFWELVETLKTANKNEVPQIVGEIYQKFFVENREIQVEKFLLK
EIQQSLVGNRGTQVFVRLQEQVAETMRERYYPSFLVSDLYDKLIRRDEQHCQSQGSPEEK
GEECQGLDAGEEECDEGTKGINEQASYAATKLRQLYDKLEYKRQALGSIQNAPKPDKKIV
SKLKEEIGAMEKEHSELQQHITRTDWWCENLGHWKATITSAEAAEESGETVACYGVCVSL
TEGEETPNSRWSVQRKLSEFQILHRKLTECFPSLKKLQVPSLSKLPFKSIDQKFLEKSKT
QLNAFLQRLLTDDRLCQSEVLYAFLSPSPEHLKVMSIQKKSSFSLASFLERLPGDFFSHT
EEDGDEDSDLSDYGDETDGRKNALAEPCFMLIGEIFELRGMFKWVRKTLIALVQVTFGRT
INKQIRDTVNWIFSEQMLVCYISVFRDTFWPDGKLAPHLESRTDSERHETKERAQQKLLD
NIPDALANLVGQQNARYGIIKIFNALQEANANKHLLYVLMEMLLKELCPELRAEVDNI
Download sequence
Identical sequences H2LYG9
ENSORLP00000011185 ENSORLP00000011185 8090.ENSORLP00000011185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]