SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012257 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012257
Domain Number 1 Region: 289-454
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.97e-37
Family PAPS reductase-like 0.03
Further Details:      
 
Domain Number 2 Region: 17-216
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 1.7e-33
Family MogA-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012257   Gene: ENSORLG00000009769   Transcript: ENSORLT00000012258
Sequence length 498
Comment pep:novel chromosome:MEDAKA1:16:15261770:15267329:1 gene:ENSORLG00000009769 transcript:ENSORLT00000012258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSRAAMSAERQSSTAAPTAAILIIGDEILKGYTVDTNSTFLTQALRRLGVSVQRITVIPD
IQEVIAKEVALLSSQYTHLFTSGGIGPTHDDVTLESIAMAFQEEMYHHPDLTLLVKEFFG
GTDKNSPAMKMAKVPRSAKLNYGVDPQTGKPQLYPVVSVRNVYVFPGIPALMERAFTGLE
QLFATSGTTFHSREVFVDADETDIAPTLTKLQASWGKRVALGSYPDWLSNYSKVRLVLDS
ESLEEVEKARIQLVEELPKGSVVTLVRDSVSIAPTEVHKLADDATMLGVKVKSALKTIEA
ALDQYSSDQICVAFNGGKDCTALLHLYYAALRRRNPDGKDKVKALYIRIVSPFPEMERFL
QDTTKRYNLELISVEGSIRQALNEVQERRPELKAVLMGTRRSDPYSQTLAPMCPTDPGWP
DYMRVNPLLDWTYHDIWSFLRTLYVPYCILYDKGYTSLGSMDNTHRNTALRMVDEKGVTR
YKPAYLLENEEEERNCRA
Download sequence
Identical sequences H2M1H4
8090.ENSORLP00000012257 ENSORLP00000012257 ENSORLP00000012257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]