SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012545 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012545
Domain Number 1 Region: 392-481
Classification Level Classification E-value
Superfamily Chromo domain-like 1.7e-19
Family Chromo domain 0.0051
Further Details:      
 
Domain Number 2 Region: 280-339
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000326
Family Reverse transcriptase 0.014
Further Details:      
 
Domain Number 3 Region: 138-229
Classification Level Classification E-value
Superfamily Acid proteases 0.000000368
Family Retroviral protease (retropepsin) 0.03
Further Details:      
 
Domain Number 4 Region: 83-113
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000523
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012545   Gene: ENSORLG00000009997   Transcript: ENSORLT00000012546
Sequence length 489
Comment pep:novel chromosome:MEDAKA1:23:3819018:3822864:-1 gene:ENSORLG00000009997 transcript:ENSORLT00000012546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEVLKDHLAPLELPPSLEPLIALVIRIDNRLQDRRRGCRSNAFPGDVLTTTNPPSSHPSS
VASTDSPVVPLEEPMQLGRGRLSPSERSAGECLYCGQRGHFCKHCPNVVGTLRNGGHAPT
CSKSTSCFLEGHVMSRGGGFPVQALLDSGAEQNLMDAELAKRVGLKTELLPRSWQVISLN
GEAVATIDQITEPVHLILSGNHHEHTRYSPHNPVVLGFPWLLAHNPVIDWPNNRINSWSN
HCHEVCLRSARHPGADSADPVGQPSSPDLSKVPSEYHDLGEVDASDTGVGAVLSQRKGAD
SKLHPCAFFSRRLNPAETNYDVGDKELLAIKLALEEKEATVPSVQHLYRRCRRIWREASA
ALLRSSAVNKRLADRHRLPAPTYTPGQLVLLSTVFHVSQLKPHVTSPLQPSPSQPPPPRI
IDGQPAWTIRRIMDVRRRGRGLQYLVDWKGYGPEERSWEPTSRMLDKDMLREFHRRHPDK
PGGAPRGAS
Download sequence
Identical sequences H2M2A5
8090.ENSORLP00000012545 ENSORLP00000012545 ENSORLP00000012545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]